Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|529
Gene name
Locationscaffold_113:10936..12088
Strand+
Gene length (bp)1152
Transcript length (bp)999
Coding sequence length (bp)996
Protein length (aa) 332

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1JQ66|S35E3_DANRE Solute carrier family 35 member E3 OS=Danio rerio GN=slc35e3 PE=2 SV=1 33 332 7.0E-44
sp|Q7Z769|S35E3_HUMAN Solute carrier family 35 member E3 OS=Homo sapiens GN=SLC35E3 PE=2 SV=1 39 331 2.0E-39
sp|A4IFK2|S35E3_BOVIN Solute carrier family 35 member E3 OS=Bos taurus GN=SLC35E3 PE=2 SV=1 34 331 1.0E-37
sp|Q6PGC7|S35E3_MOUSE Solute carrier family 35 member E3 OS=Mus musculus GN=Slc35e3 PE=2 SV=1 39 331 1.0E-37
sp|Q8RXL8|Y1689_ARATH Uncharacterized membrane protein At1g06890 OS=Arabidopsis thaliana GN=At1g06890 PE=1 SV=1 50 322 6.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1JQ66|S35E3_DANRE Solute carrier family 35 member E3 OS=Danio rerio GN=slc35e3 PE=2 SV=1 33 332 7.0E-44
sp|Q7Z769|S35E3_HUMAN Solute carrier family 35 member E3 OS=Homo sapiens GN=SLC35E3 PE=2 SV=1 39 331 2.0E-39
sp|A4IFK2|S35E3_BOVIN Solute carrier family 35 member E3 OS=Bos taurus GN=SLC35E3 PE=2 SV=1 34 331 1.0E-37
sp|Q6PGC7|S35E3_MOUSE Solute carrier family 35 member E3 OS=Mus musculus GN=Slc35e3 PE=2 SV=1 39 331 1.0E-37
sp|Q8RXL8|Y1689_ARATH Uncharacterized membrane protein At1g06890 OS=Arabidopsis thaliana GN=At1g06890 PE=1 SV=1 50 322 6.0E-21
sp|Q9SRE4|UGAL2_ARATH UDP-galactose transporter 2 OS=Arabidopsis thaliana GN=UDP-GALT2 PE=2 SV=1 23 322 1.0E-20
sp|Q550W6|FUCT1_DICDI GDP-fucose transporter 1 OS=Dictyostelium discoideum GN=slc35c1 PE=3 SV=1 43 323 5.0E-10
sp|Q9SFE9|GONS5_ARATH GDP-mannose transporter GONST5 OS=Arabidopsis thaliana GN=GONST5 PE=2 SV=1 97 332 9.0E-09
sp|Q9C521|UGAL1_ARATH UDP-galactose transporter 1 OS=Arabidopsis thaliana GN=UDP-GALT1 PE=2 SV=1 97 332 7.0E-08
sp|Q6DBP3|PT505_ARATH Probable sugar phosphate/phosphate translocator At5g05820 OS=Arabidopsis thaliana GN=At5g05820 PE=2 SV=1 93 322 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.5

Transmembrane Domains

Domain # Start End Length
1 32 54 22
2 66 88 22
3 103 125 22
4 138 169 31
5 184 206 22
6 218 237 19
7 252 274 22
8 281 298 17
9 308 326 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|529
MEKATDSLPASSDEELGLTVNDDSPSPRLAVAVAWMAVNTLATVGIVFTNKAIFSDPSWRQSQLTFASFHFFVTW
ITLLVLANPTFAYFAPRRVSVRHLLPLALAMCLNVILPNCSLAFSSVTFYQVARVLLTPAVALVNFVLYGATLPP
LAGLALVPVCLGVGIVSYYDSLPAADAHIKTTSPLGVVFAMAGVLASSLYTVWIASYHKKLQMTSMQLLYSQAPI
ASFMLLYAIPFLDTLPDPSHVSTPRWLMVILSGAFASLINMSQFFIVAHTGPVSSTVVGHVKTCTIVCIGWIVSG
RSAGDRALVGVFLAMAAILLYSIVMLKARKSG
Coding >Ophio5|529
ATGGAAAAGGCCACGGACTCGTTGCCAGCCTCCTCAGACGAGGAGCTCGGCTTGACCGTCAACGACGATAGCCCC
TCGCCCCGGCTCGCCGTCGCCGTCGCCTGGATGGCCGTCAACACCTTGGCCACGGTTGGAATCGTCTTCACCAAT
AAAGCCATCTTCTCGGATCCCTCGTGGCGCCAGTCTCAGCTCACCTTTGCCAGCTTCCACTTCTTCGTCACTTGG
ATCACCCTCCTCGTGCTCGCCAATCCGACCTTTGCCTACTTCGCTCCCCGCCGCGTTTCCGTTCGCCATCTGCTT
CCCCTTGCCCTCGCCATGTGTCTCAATGTCATCCTTCCCAACTGCTCCTTGGCCTTCTCCTCCGTCACCTTCTAC
CAGGTCGCACGTGTCTTGCTGACGCCTGCCGTGGCGCTCGTCAACTTTGTCCTATACGGCGCCACGCTGCCACCG
CTCGCCGGCCTGGCCCTAGTTCCGGTCTGCCTCGGCGTCGGCATCGTATCTTACTACGACTCTCTCCCAGCTGCC
GATGCACACATCAAGACCACGTCGCCCCTGGGCGTCGTCTTTGCCATGGCAGGAGTCCTGGCCTCTTCCCTCTAT
ACCGTGTGGATCGCCAGCTATCACAAAAAGCTACAGATGACTAGCATGCAGCTGCTCTATAGCCAAGCACCCATC
GCCTCATTCATGCTCCTTTACGCCATTCCCTTTCTCGATACGCTTCCTGATCCGAGTCATGTTTCCACGCCTAGA
TGGCTGATGGTGATCCTGTCCGGAGCCTTTGCCTCCCTCATCAACATGTCACAATTCTTCATCGTCGCTCACACC
GGCCCCGTGTCGAGCACTGTCGTCGGCCACGTCAAGACGTGCACCATTGTGTGTATCGGATGGATCGTATCGGGC
CGTTCTGCCGGCGACAGAGCCCTGGTTGGCGTATTTCTTGCCATGGCCGCAATCCTACTGTACTCTATCGTCATG
TTGAAGGCTCGCAAGTCGGGA
Transcript >Ophio5|529
ATGGAAAAGGCCACGGACTCGTTGCCAGCCTCCTCAGACGAGGAGCTCGGCTTGACCGTCAACGACGATAGCCCC
TCGCCCCGGCTCGCCGTCGCCGTCGCCTGGATGGCCGTCAACACCTTGGCCACGGTTGGAATCGTCTTCACCAAT
AAAGCCATCTTCTCGGATCCCTCGTGGCGCCAGTCTCAGCTCACCTTTGCCAGCTTCCACTTCTTCGTCACTTGG
ATCACCCTCCTCGTGCTCGCCAATCCGACCTTTGCCTACTTCGCTCCCCGCCGCGTTTCCGTTCGCCATCTGCTT
CCCCTTGCCCTCGCCATGTGTCTCAATGTCATCCTTCCCAACTGCTCCTTGGCCTTCTCCTCCGTCACCTTCTAC
CAGGTCGCACGTGTCTTGCTGACGCCTGCCGTGGCGCTCGTCAACTTTGTCCTATACGGCGCCACGCTGCCACCG
CTCGCCGGCCTGGCCCTAGTTCCGGTCTGCCTCGGCGTCGGCATCGTATCTTACTACGACTCTCTCCCAGCTGCC
GATGCACACATCAAGACCACGTCGCCCCTGGGCGTCGTCTTTGCCATGGCAGGAGTCCTGGCCTCTTCCCTCTAT
ACCGTGTGGATCGCCAGCTATCACAAAAAGCTACAGATGACTAGCATGCAGCTGCTCTATAGCCAAGCACCCATC
GCCTCATTCATGCTCCTTTACGCCATTCCCTTTCTCGATACGCTTCCTGATCCGAGTCATGTTTCCACGCCTAGA
TGGCTGATGGTGATCCTGTCCGGAGCCTTTGCCTCCCTCATCAACATGTCACAATTCTTCATCGTCGCTCACACC
GGCCCCGTGTCGAGCACTGTCGTCGGCCACGTCAAGACGTGCACCATTGTGTGTATCGGATGGATCGTATCGGGC
CGTTCTGCCGGCGACAGAGCCCTGGTTGGCGTATTTCTTGCCATGGCCGCAATCCTACTGTACTCTATCGTCATG
TTGAAGGCTCGCAAGTCGGGATAG
Gene >Ophio5|529
ATGGAAAAGGCCACGGACTCGTTGCCAGCCTCCTCAGACGAGGAGCTCGGCTTGACCGTCAACGACGATAGCCCC
TCGCCCCGGCTCGCCGTCGCCGTCGCCTGGATGGCCGTCAACACCTTGGCCACGGTTGGAATCGTATGCTAAGCA
CCGTGTTGAAGACGCTGCCGCTGCCGCTCACCATCAACACCTTGCAGGTCTTCACCAATAAAGCCATCTTCTCGG
ATCCCTCGTGGCGCCAGTCTCAGCTCACCTTTGCCAGCTTCCACTTCTTCGTCACTTGGATCACCCTCCTCGTGC
TCGCCAATCCGACCTTTGCCTACTTCGCTCCCCGCCGCGTTTCCGTTCGCCATCTGCTTCCCCTTGCCCTCGCCA
TGTGTCTCAATGTCATCCTTCCCAACTGCTCCTTGGCCTTCTCCTCCGTCACCTTCTACCAGGTCGCACGTGTCT
TGCTGACGCCTGCCGTGGCGCTCGTCAACTTTGTCCTATACGGCGCCACGCTGCCACCGCTCGCCGGCCTGGCCC
TAGTTCCGGTCTGCCTCGGCGTCGGCATCGTATCTTACTACGACTCTCTCCCAGCTGCCGATGCACACATCAAGA
CCACGTCGCCCCTGGGCGTCGTCTTTGCCATGGCAGGAGTCCTGGCCTCTTCCCTCTATACCGTGTGGATCGCCA
GCTATCACAAAAAGCTACAGATGACTAGCATGCAGCTGCTCTATAGCCAAGCACCCATCGCCTCATTCATGCTCC
TTTACGCCATTCCCTTTCTCGATACGCTTCCTGATCCGAGTCATGTTTCCACGCCTAGATGGCTGATGGTGATCC
TGGTATGTGATTCCCTCTCCTTGTATCGCGGCACTGACATGCCCAGTCCGGAGCCTTTGCCTCCCTCATCAACAT
GTCACAATTCTTCATCGTCGCTCACACCGGCCCCGTGTCGAGCACTGTCGTCGGCCACGTCAAGACGTGCACCAT
TGTGTGTATCGGATGGATCGTATCGGGCCGTTCTGCCGGCGACAGAGCCCTGGTTGGCGTATTTCTTGCCATGGC
CGCAATCCTACTGTGAGTCACTTGATTTGGCCTTATGCATGCGCCACTCATCGCCGTCGCAGGTACTCTATCGTC
ATGTTGAAGGCTCGCAAGTCGGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail