Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5282
Gene name
Locationscaffold_429:6574..10106
Strand+
Gene length (bp)3532
Transcript length (bp)3414
Coding sequence length (bp)3411
Protein length (aa) 1137

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02891 zf-MIZ MIZ/SP-RING zinc finger 1.5E-08 999 1054

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O88907|PIAS1_MOUSE E3 SUMO-protein ligase PIAS1 OS=Mus musculus GN=Pias1 PE=1 SV=2 868 1109 6.0E-12
sp|O75925|PIAS1_HUMAN E3 SUMO-protein ligase PIAS1 OS=Homo sapiens GN=PIAS1 PE=1 SV=2 868 1106 2.0E-11
sp|O54714|PIAS3_MOUSE E3 SUMO-protein ligase PIAS3 OS=Mus musculus GN=Pias3 PE=1 SV=3 868 1130 7.0E-11
sp|Q9Y6X2|PIAS3_HUMAN E3 SUMO-protein ligase PIAS3 OS=Homo sapiens GN=PIAS3 PE=1 SV=2 868 1111 1.0E-10
sp|Q6AZ28|PIAS2_RAT E3 SUMO-protein ligase PIAS2 OS=Rattus norvegicus GN=Pias2 PE=1 SV=1 909 1135 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O88907|PIAS1_MOUSE E3 SUMO-protein ligase PIAS1 OS=Mus musculus GN=Pias1 PE=1 SV=2 868 1109 6.0E-12
sp|O75925|PIAS1_HUMAN E3 SUMO-protein ligase PIAS1 OS=Homo sapiens GN=PIAS1 PE=1 SV=2 868 1106 2.0E-11
sp|O54714|PIAS3_MOUSE E3 SUMO-protein ligase PIAS3 OS=Mus musculus GN=Pias3 PE=1 SV=3 868 1130 7.0E-11
sp|Q9Y6X2|PIAS3_HUMAN E3 SUMO-protein ligase PIAS3 OS=Homo sapiens GN=PIAS3 PE=1 SV=2 868 1111 1.0E-10
sp|Q6AZ28|PIAS2_RAT E3 SUMO-protein ligase PIAS2 OS=Rattus norvegicus GN=Pias2 PE=1 SV=1 909 1135 1.0E-10
sp|Q94361|GEI17_CAEEL E3 SUMO-protein ligase gei-17 OS=Caenorhabditis elegans GN=gei-17 PE=1 SV=4 942 1099 2.0E-10
sp|O70260|PIAS3_RAT E3 SUMO-protein ligase PIAS3 OS=Rattus norvegicus GN=Pias3 PE=1 SV=2 868 1111 2.0E-10
sp|Q8C5D8|PIAS2_MOUSE E3 SUMO-protein ligase PIAS2 OS=Mus musculus GN=Pias2 PE=1 SV=2 909 1135 2.0E-10
sp|O75928|PIAS2_HUMAN E3 SUMO-protein ligase PIAS2 OS=Homo sapiens GN=PIAS2 PE=1 SV=3 909 1112 5.0E-10
sp|O94451|PLI1_SCHPO E3 SUMO-protein ligase pli1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pli1 PE=1 SV=3 968 1106 3.0E-09
sp|Q8N2W9|PIAS4_HUMAN E3 SUMO-protein ligase PIAS4 OS=Homo sapiens GN=PIAS4 PE=1 SV=1 892 1097 1.0E-08
sp|Q8CIE2|ZMIZ2_MOUSE Zinc finger MIZ domain-containing protein 2 OS=Mus musculus GN=Zmiz2 PE=2 SV=2 880 1098 2.0E-08
sp|Q8NF64|ZMIZ2_HUMAN Zinc finger MIZ domain-containing protein 2 OS=Homo sapiens GN=ZMIZ2 PE=1 SV=2 880 1098 2.0E-08
sp|Q9JM05|PIAS4_MOUSE E3 SUMO-protein ligase PIAS4 OS=Mus musculus GN=Pias4 PE=1 SV=2 892 1097 3.0E-08
sp|Q12216|SIZ2_YEAST E3 SUMO-protein ligase SIZ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFI1 PE=1 SV=1 936 1097 1.0E-06
sp|Q680Q4|SIZ1_ARATH E3 SUMO-protein ligase SIZ1 OS=Arabidopsis thaliana GN=SIZ1 PE=1 SV=2 883 1094 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.4808 0.911 0.0374 0.0551 0.0218 0.0026 0.0535 0.0783 0.0597 0.0055

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, MIZ-type

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup755
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5303
Ophiocordyceps australis map64 (Brazil) OphauB2|3841
Ophiocordyceps camponoti-floridani Ophcf2|00931
Ophiocordyceps camponoti-floridani Ophcf2|00932
Ophiocordyceps camponoti-rufipedis Ophun1|4955
Ophiocordyceps kimflemingae Ophio5|5282 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2359

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5282
MPAQKRRPHEAVRPPLDASNETSRAFLGVQRRAWMMTTGSDVPAVALSKSCAQTGPEPPPVVISPSVFTAPPNAT
SVFPSPVNSSVSSPEASTSGPGTAGSPSIVDAPPSDSDMIAAPPTAQVPSPPSFDPPPAHVTSASVDVEGRDRVL
ADESGSGSENLPMNLVTTHQNVTAAAKRRSTTHTELTLSTTSAQLEAPSAAEANTTPRATQPNSPNAATNLMTPR
HQPAHIQGRPSSEVPGTQPKRHCSPASRQLVAAHNGNPVNFHHLYAVIESRLRDFQGANLPSQDAFFYKLLVSAC
SRGDFFYLVFHQAFCLWSLNNQHAYAFLQAKPQVADSAFHILLRIWRQNSDISLTHLWWFASFPVTLASTETDPC
GTQRRRIPHHQVTGFMPLINKFLEKLALSWSLVLVQVVQRGYPLMAWELNRVLECASPVLRWVLFICSRKAFGIR
EGPATQDLGRLFEIDWRNESARAFDSPETVQMRKVTRDRYIAIIQEARGSLLNHGSAANQQLLLAQQAASMQNTL
STPQHWQHVASLSPFHPTPMALPTLSPPYNNGSHAVAPQVPVMDGNTNVGVAQGLTQPHQVSSGFSSSPSVAGRG
QTQTAGVFTSPVTSNMQAQAASYLTQTETAVQQIQMMLATQRPVSLATNCVVQRTATVSVPPGRGPNPYPQQQLA
PQAIQPQQIAPRATQPQQIAPQATQLQQTSPQAMQPAAGWSRARLLPRHTPQVAHPPCPEYRTATASGQAGVRVP
PTDAMPSQHQVSPLHEHQIPRDDWSRAQTSLHLSYLRSPKRACSTPSDKRYYQFMTHFAAVPQAFTPQPGLRILR
FSLSQDEASNLVTSPPASDVPMALFRDGSLRYRLRLCKQSQATQQVQERVWTGCSTYWPPHIFLECNDQSVQPRR
RQHFQYDLPIELTGLLRSGENSVRVSLPRVGNGDQDWTYFMGVEVIKTLDHDTVRAMVESNSRTSAEETKRKVNQ
RLKQDDSNDIIAQDEHICVAVTDPFSSSLFTTPVRGADCKHLECFDLDIWLRTRPGRHSGSGNKHEPSTADCWKC
PICDLDARPVCLHIDDFFTEVRAKLVEDGEDAIKKISIQPDGTWSPLPEADEAEEAVMSPATSGHERPGLPQAAR
SASVQAIVIDDD
Coding >Ophio5|5282
ATGCCAGCTCAAAAGCGTCGCCCTCATGAGGCGGTGCGTCCGCCCCTCGATGCGAGCAATGAAACATCGCGCGCC
TTTCTTGGTGTGCAACGCCGGGCGTGGATGATGACGACTGGCTCTGACGTGCCCGCTGTCGCCCTCTCCAAGAGC
TGCGCCCAGACGGGTCCAGAACCTCCTCCCGTCGTCATTTCTCCGTCCGTCTTCACCGCACCCCCGAATGCCACT
TCTGTCTTCCCGTCGCCCGTGAATTCCAGCGTCTCGAGCCCCGAGGCTTCGACCTCGGGGCCGGGCACGGCTGGC
AGCCCCTCGATAGTCGATGCGCCGCCTTCGGACTCTGATATGATAGCCGCTCCTCCGACAGCGCAGGTCCCGAGC
CCGCCGTCCTTCGATCCTCCTCCGGCTCATGTAACAAGCGCCTCCGTCGACGTTGAAGGACGAGATCGGGTTCTG
GCCGACGAATCCGGTTCAGGCTCGGAGAATTTGCCGATGAACCTCGTGACGACACATCAAAACGTCACAGCCGCT
GCGAAAAGGCGCTCGACGACTCACACTGAGCTGACTCTATCGACCACATCGGCCCAGCTCGAGGCACCGTCCGCT
GCCGAAGCAAATACGACACCTCGGGCGACCCAGCCAAACTCACCAAACGCTGCCACAAACCTCATGACGCCTCGC
CACCAGCCGGCTCACATCCAAGGAAGGCCGTCGAGTGAGGTGCCGGGCACACAGCCCAAACGGCATTGTTCCCCT
GCTTCACGGCAGCTTGTGGCAGCCCATAACGGTAATCCGGTCAATTTTCACCACTTATACGCCGTCATCGAAAGT
CGTCTACGGGACTTTCAAGGCGCTAACTTGCCAAGCCAAGATGCCTTCTTTTATAAGCTGCTGGTTTCGGCTTGC
TCCAGGGGGGATTTTTTTTATCTTGTCTTCCACCAGGCATTTTGCCTCTGGTCACTGAACAACCAGCACGCCTAT
GCCTTCCTTCAGGCCAAGCCACAGGTCGCCGACTCAGCTTTCCATATCCTGCTCCGAATCTGGAGACAAAACTCG
GACATATCGTTGACTCACCTCTGGTGGTTCGCCTCGTTCCCTGTCACATTAGCCTCGACAGAAACGGACCCGTGT
GGAACTCAGAGGAGACGTATTCCCCACCATCAGGTTACCGGCTTCATGCCTCTGATCAACAAATTCTTGGAGAAG
TTGGCACTCAGCTGGAGCCTCGTCCTAGTTCAGGTCGTTCAGAGAGGCTATCCGCTGATGGCGTGGGAATTAAAC
AGAGTCTTGGAGTGCGCATCGCCGGTGCTGCGATGGGTCCTCTTCATCTGTAGTCGCAAAGCCTTCGGCATCCGC
GAAGGCCCTGCCACGCAGGACTTGGGGCGGCTATTCGAGATCGATTGGCGCAACGAATCGGCTCGAGCCTTCGAC
TCACCCGAGACGGTCCAGATGCGAAAGGTAACAAGGGATAGGTATATCGCAATAATACAAGAAGCCAGAGGCTCT
TTACTCAACCACGGATCTGCTGCCAACCAGCAGCTGCTGCTGGCGCAGCAGGCCGCAAGCATGCAAAACACACTA
TCGACGCCGCAGCACTGGCAGCATGTGGCATCGCTGTCACCCTTCCACCCTACTCCGATGGCTTTACCGACCCTT
TCGCCGCCTTACAACAACGGTAGCCATGCAGTGGCCCCTCAAGTGCCCGTCATGGACGGCAATACCAACGTCGGT
GTTGCCCAAGGACTGACCCAGCCTCACCAGGTTTCATCCGGTTTCTCCTCTTCGCCGTCTGTCGCTGGTCGCGGG
CAGACGCAGACGGCTGGTGTTTTTACTTCACCCGTAACGTCGAATATGCAGGCGCAGGCTGCGTCGTATCTCACA
CAAACCGAGACGGCCGTCCAGCAGATACAGATGATGCTAGCAACGCAGCGTCCGGTGTCTTTGGCTACCAACTGC
GTCGTGCAAAGGACGGCAACAGTGAGCGTCCCACCAGGTCGTGGCCCCAACCCTTATCCACAGCAGCAACTTGCT
CCGCAGGCTATACAGCCTCAGCAAATCGCTCCTCGGGCTACACAGCCTCAGCAAATTGCTCCTCAGGCTACACAG
CTTCAGCAAACCTCTCCTCAGGCTATGCAGCCTGCAGCTGGCTGGTCTCGTGCGAGGCTGCTTCCCAGGCACACG
CCTCAGGTCGCCCATCCTCCTTGTCCAGAGTATCGAACCGCAACCGCGTCAGGGCAAGCTGGAGTTCGCGTGCCG
CCGACAGACGCAATGCCTAGCCAGCATCAAGTCAGTCCACTGCATGAGCATCAAATCCCTCGAGACGACTGGTCG
CGAGCTCAGACTAGCCTGCACTTGTCGTACTTGCGCAGCCCCAAGAGGGCTTGTTCGACACCCTCTGACAAACGC
TATTATCAATTCATGACGCACTTCGCCGCAGTACCGCAAGCTTTCACTCCCCAGCCTGGCCTGAGGATTTTGCGC
TTTTCTCTATCGCAGGACGAAGCGTCCAACTTAGTCACCTCGCCCCCGGCGAGCGATGTGCCGATGGCCCTGTTC
CGCGACGGGTCCCTTCGGTATCGCCTCCGATTATGCAAACAAAGTCAAGCGACTCAGCAAGTGCAGGAGAGAGTT
TGGACAGGGTGCTCGACCTACTGGCCTCCTCACATATTCCTGGAATGCAATGACCAGTCCGTGCAGCCTCGGCGG
CGCCAACACTTTCAGTACGATCTTCCCATAGAGCTGACTGGCCTGTTGCGCTCTGGGGAAAACTCGGTTCGAGTC
AGCTTACCTCGGGTCGGAAATGGTGACCAGGATTGGACCTATTTCATGGGAGTGGAGGTAATCAAAACTCTGGAC
CACGATACCGTCCGTGCTATGGTTGAATCAAACTCTCGGACCAGCGCCGAGGAGACCAAGCGGAAAGTGAACCAG
CGACTGAAGCAGGATGACTCCAACGATATCATCGCCCAGGACGAACACATTTGCGTGGCAGTGACGGATCCTTTT
AGTTCTTCCCTCTTCACGACTCCTGTCCGAGGAGCGGATTGCAAACATTTGGAATGCTTCGACCTGGATATTTGG
CTGCGAACTCGCCCAGGAAGACACTCAGGCTCCGGGAACAAGCACGAACCGAGCACGGCCGATTGCTGGAAATGT
CCTATTTGTGATCTCGACGCGAGACCCGTCTGCCTCCACATCGACGACTTCTTCACGGAGGTGCGCGCAAAGCTC
GTTGAGGACGGCGAAGACGCCATAAAAAAAATTAGCATTCAACCTGATGGAACCTGGAGCCCGCTGCCGGAAGCC
GACGAGGCCGAAGAGGCGGTGATGTCGCCCGCCACGTCCGGCCACGAGCGGCCCGGTCTCCCGCAGGCAGCGCGC
TCGGCATCAGTGCAGGCGATTGTCATCGACGATGAC
Transcript >Ophio5|5282
ATGCCAGCTCAAAAGCGTCGCCCTCATGAGGCGGTGCGTCCGCCCCTCGATGCGAGCAATGAAACATCGCGCGCC
TTTCTTGGTGTGCAACGCCGGGCGTGGATGATGACGACTGGCTCTGACGTGCCCGCTGTCGCCCTCTCCAAGAGC
TGCGCCCAGACGGGTCCAGAACCTCCTCCCGTCGTCATTTCTCCGTCCGTCTTCACCGCACCCCCGAATGCCACT
TCTGTCTTCCCGTCGCCCGTGAATTCCAGCGTCTCGAGCCCCGAGGCTTCGACCTCGGGGCCGGGCACGGCTGGC
AGCCCCTCGATAGTCGATGCGCCGCCTTCGGACTCTGATATGATAGCCGCTCCTCCGACAGCGCAGGTCCCGAGC
CCGCCGTCCTTCGATCCTCCTCCGGCTCATGTAACAAGCGCCTCCGTCGACGTTGAAGGACGAGATCGGGTTCTG
GCCGACGAATCCGGTTCAGGCTCGGAGAATTTGCCGATGAACCTCGTGACGACACATCAAAACGTCACAGCCGCT
GCGAAAAGGCGCTCGACGACTCACACTGAGCTGACTCTATCGACCACATCGGCCCAGCTCGAGGCACCGTCCGCT
GCCGAAGCAAATACGACACCTCGGGCGACCCAGCCAAACTCACCAAACGCTGCCACAAACCTCATGACGCCTCGC
CACCAGCCGGCTCACATCCAAGGAAGGCCGTCGAGTGAGGTGCCGGGCACACAGCCCAAACGGCATTGTTCCCCT
GCTTCACGGCAGCTTGTGGCAGCCCATAACGGTAATCCGGTCAATTTTCACCACTTATACGCCGTCATCGAAAGT
CGTCTACGGGACTTTCAAGGCGCTAACTTGCCAAGCCAAGATGCCTTCTTTTATAAGCTGCTGGTTTCGGCTTGC
TCCAGGGGGGATTTTTTTTATCTTGTCTTCCACCAGGCATTTTGCCTCTGGTCACTGAACAACCAGCACGCCTAT
GCCTTCCTTCAGGCCAAGCCACAGGTCGCCGACTCAGCTTTCCATATCCTGCTCCGAATCTGGAGACAAAACTCG
GACATATCGTTGACTCACCTCTGGTGGTTCGCCTCGTTCCCTGTCACATTAGCCTCGACAGAAACGGACCCGTGT
GGAACTCAGAGGAGACGTATTCCCCACCATCAGGTTACCGGCTTCATGCCTCTGATCAACAAATTCTTGGAGAAG
TTGGCACTCAGCTGGAGCCTCGTCCTAGTTCAGGTCGTTCAGAGAGGCTATCCGCTGATGGCGTGGGAATTAAAC
AGAGTCTTGGAGTGCGCATCGCCGGTGCTGCGATGGGTCCTCTTCATCTGTAGTCGCAAAGCCTTCGGCATCCGC
GAAGGCCCTGCCACGCAGGACTTGGGGCGGCTATTCGAGATCGATTGGCGCAACGAATCGGCTCGAGCCTTCGAC
TCACCCGAGACGGTCCAGATGCGAAAGGTAACAAGGGATAGGTATATCGCAATAATACAAGAAGCCAGAGGCTCT
TTACTCAACCACGGATCTGCTGCCAACCAGCAGCTGCTGCTGGCGCAGCAGGCCGCAAGCATGCAAAACACACTA
TCGACGCCGCAGCACTGGCAGCATGTGGCATCGCTGTCACCCTTCCACCCTACTCCGATGGCTTTACCGACCCTT
TCGCCGCCTTACAACAACGGTAGCCATGCAGTGGCCCCTCAAGTGCCCGTCATGGACGGCAATACCAACGTCGGT
GTTGCCCAAGGACTGACCCAGCCTCACCAGGTTTCATCCGGTTTCTCCTCTTCGCCGTCTGTCGCTGGTCGCGGG
CAGACGCAGACGGCTGGTGTTTTTACTTCACCCGTAACGTCGAATATGCAGGCGCAGGCTGCGTCGTATCTCACA
CAAACCGAGACGGCCGTCCAGCAGATACAGATGATGCTAGCAACGCAGCGTCCGGTGTCTTTGGCTACCAACTGC
GTCGTGCAAAGGACGGCAACAGTGAGCGTCCCACCAGGTCGTGGCCCCAACCCTTATCCACAGCAGCAACTTGCT
CCGCAGGCTATACAGCCTCAGCAAATCGCTCCTCGGGCTACACAGCCTCAGCAAATTGCTCCTCAGGCTACACAG
CTTCAGCAAACCTCTCCTCAGGCTATGCAGCCTGCAGCTGGCTGGTCTCGTGCGAGGCTGCTTCCCAGGCACACG
CCTCAGGTCGCCCATCCTCCTTGTCCAGAGTATCGAACCGCAACCGCGTCAGGGCAAGCTGGAGTTCGCGTGCCG
CCGACAGACGCAATGCCTAGCCAGCATCAAGTCAGTCCACTGCATGAGCATCAAATCCCTCGAGACGACTGGTCG
CGAGCTCAGACTAGCCTGCACTTGTCGTACTTGCGCAGCCCCAAGAGGGCTTGTTCGACACCCTCTGACAAACGC
TATTATCAATTCATGACGCACTTCGCCGCAGTACCGCAAGCTTTCACTCCCCAGCCTGGCCTGAGGATTTTGCGC
TTTTCTCTATCGCAGGACGAAGCGTCCAACTTAGTCACCTCGCCCCCGGCGAGCGATGTGCCGATGGCCCTGTTC
CGCGACGGGTCCCTTCGGTATCGCCTCCGATTATGCAAACAAAGTCAAGCGACTCAGCAAGTGCAGGAGAGAGTT
TGGACAGGGTGCTCGACCTACTGGCCTCCTCACATATTCCTGGAATGCAATGACCAGTCCGTGCAGCCTCGGCGG
CGCCAACACTTTCAGTACGATCTTCCCATAGAGCTGACTGGCCTGTTGCGCTCTGGGGAAAACTCGGTTCGAGTC
AGCTTACCTCGGGTCGGAAATGGTGACCAGGATTGGACCTATTTCATGGGAGTGGAGGTAATCAAAACTCTGGAC
CACGATACCGTCCGTGCTATGGTTGAATCAAACTCTCGGACCAGCGCCGAGGAGACCAAGCGGAAAGTGAACCAG
CGACTGAAGCAGGATGACTCCAACGATATCATCGCCCAGGACGAACACATTTGCGTGGCAGTGACGGATCCTTTT
AGTTCTTCCCTCTTCACGACTCCTGTCCGAGGAGCGGATTGCAAACATTTGGAATGCTTCGACCTGGATATTTGG
CTGCGAACTCGCCCAGGAAGACACTCAGGCTCCGGGAACAAGCACGAACCGAGCACGGCCGATTGCTGGAAATGT
CCTATTTGTGATCTCGACGCGAGACCCGTCTGCCTCCACATCGACGACTTCTTCACGGAGGTGCGCGCAAAGCTC
GTTGAGGACGGCGAAGACGCCATAAAAAAAATTAGCATTCAACCTGATGGAACCTGGAGCCCGCTGCCGGAAGCC
GACGAGGCCGAAGAGGCGGTGATGTCGCCCGCCACGTCCGGCCACGAGCGGCCCGGTCTCCCGCAGGCAGCGCGC
TCGGCATCAGTGCAGGCGATTGTCATCGACGATGACTAG
Gene >Ophio5|5282
ATGCCAGCTCAAAAGCGTCGCCCTCATGAGGCGGTGCGTCCGCCCCTCGATGCGAGCAATGAAACATCGCGCGCC
TTTCTTGGTGTGCAACGCCGGGCGTGGATGATGACGACTGGCTCTGACGTGCCCGCTGTCGCCCTCTCCAAGAGC
TGCGCCCAGACGGGTCCAGAACCTCCTCCCGTCGTCATTTCTCCGTCCGTCTTCACCGCACCCCCGAAGTCAGTC
TCGCTTCCTTCCGAATCCTGTTTTCCCAGACGTTCAGGCTAACAAATCTCGAATGCAGTGCCACTTCTGTCTTCC
CGTCGCCCGTGAATTCCAGCGTCTCGAGCCCCGAGGCTTCGACCTCGGGGCCGGGCACGGCTGGCAGCCCCTCGA
TAGTCGATGCGCCGCCTTCGGACTCTGATATGATAGCCGCTCCTCCGACAGCGCAGGTCCCGAGCCCGCCGTCCT
TCGATCCTCCTCCGGCTCATGTAACAAGCGCCTCCGTCGACGTTGAAGGACGAGATCGGGTTCTGGCCGACGAAT
CCGGTTCAGGCTCGGAGAATTTGCCGATGAACCTCGTGACGACACATCAAAACGTCACAGCCGCTGCGAAAAGGC
GCTCGACGACTCACACTGAGCTGACTCTATCGACCACATCGGCCCAGCTCGAGGCACCGTCCGCTGCCGAAGCAA
ATACGACACCTCGGGCGACCCAGCCAAACTCACCAAACGCTGCCACAAACCTCATGACGCCTCGCCACCAGCCGG
CTCACATCCAAGGAAGGCCGTCGAGTGAGGTGCCGGGCACACAGCCCAAACGGCATTGTTCCCCTGCTTCACGGC
AGCTTGTGGCAGCCCATAACGGTAATCCGGTCAATTTTCACCACTTATACGCCGTCATCGAAAGTCGTCTACGGG
ACTTTCAAGGCGCTAACTTGCCAAGCCAAGATGCCTTCTTTTATAAGCTGCTGGTTTCGGCTTGCTCCAGGGGGG
ATTTTTTTTATCTTGTCTTCCACCAGGCATTTTGCCTCTGGTCACTGAACAACCAGCACGCCTATGCCTTCCTTC
AGGCCAAGCCACAGGTCGCCGACTCAGCTTTCCATATCCTGCTCCGAATCTGGAGACAAAACTCGGACATATCGT
TGACTCACCTCTGGTGGTTCGCCTCGTTCCCTGTCACATTAGCCTCGACAGAAACGGACCCGTGTGGAACTCAGA
GGAGACGTATTCCCCACCATCAGGTTACCGGCTTCATGCCTCTGATCAACAAATTCTTGGAGAAGTTGGCACTCA
GCTGGAGCCTCGTCCTAGTTCAGGTCGTTCAGAGAGGCTATCCGCTGATGGCGTGGGAATTAAACAGAGTCTTGG
AGTGCGCATCGCCGGTGCTGCGATGGGTCCTCTTCATCTGTAGTCGCAAAGCCTTCGGCATCCGCGAAGGCCCTG
CCACGCAGGACTTGGGGCGGCTATTCGAGATCGATTGGCGCAACGAATCGGCTCGAGCCTTCGACTCACCCGAGA
CGGTCCAGATGCGAAAGGTAACAAGGGATAGGTATATCGCAATAATACAAGAAGCCAGAGGTTTGTCGTCGTACT
CTTGAGAGTCTTGTTGTTGGCTGACGTGTCGGACTTAGGCTCTTTACTCAACCACGGATCTGCTGCCAACCAGCA
GCTGCTGCTGGCGCAGCAGGCCGCAAGCATGCAAAACACACTATCGACGCCGCAGCACTGGCAGCATGTGGCATC
GCTGTCACCCTTCCACCCTACTCCGATGGCTTTACCGACCCTTTCGCCGCCTTACAACAACGGTAGCCATGCAGT
GGCCCCTCAAGTGCCCGTCATGGACGGCAATACCAACGTCGGTGTTGCCCAAGGACTGACCCAGCCTCACCAGGT
TTCATCCGGTTTCTCCTCTTCGCCGTCTGTCGCTGGTCGCGGGCAGACGCAGACGGCTGGTGTTTTTACTTCACC
CGTAACGTCGAATATGCAGGCGCAGGCTGCGTCGTATCTCACACAAACCGAGACGGCCGTCCAGCAGATACAGAT
GATGCTAGCAACGCAGCGTCCGGTGTCTTTGGCTACCAACTGCGTCGTGCAAAGGACGGCAACAGTGAGCGTCCC
ACCAGGTCGTGGCCCCAACCCTTATCCACAGCAGCAACTTGCTCCGCAGGCTATACAGCCTCAGCAAATCGCTCC
TCGGGCTACACAGCCTCAGCAAATTGCTCCTCAGGCTACACAGCTTCAGCAAACCTCTCCTCAGGCTATGCAGCC
TGCAGCTGGCTGGTCTCGTGCGAGGCTGCTTCCCAGGCACACGCCTCAGGTCGCCCATCCTCCTTGTCCAGAGTA
TCGAACCGCAACCGCGTCAGGGCAAGCTGGAGTTCGCGTGCCGCCGACAGACGCAATGCCTAGCCAGCATCAAGT
CAGTCCACTGCATGAGCATCAAATCCCTCGAGACGACTGGTCGCGAGCTCAGACTAGCCTGCACTTGTCGTACTT
GCGCAGCCCCAAGAGGGCTTGTTCGACACCCTCTGACAAACGCTATTATCAATTCATGACGCACTTCGCCGCAGT
ACCGCAAGCTTTCACTCCCCAGCCTGGCCTGAGGATTTTGCGCTTTTCTCTATCGCAGGACGAAGCGTCCAACTT
AGTCACCTCGCCCCCGGCGAGCGATGTGCCGATGGCCCTGTTCCGCGACGGGTCCCTTCGGTATCGCCTCCGATT
ATGCAAACAAAGTCAAGCGACTCAGCAAGTGCAGGAGAGAGTTTGGACAGGGTGCTCGACCTACTGGCCTCCTCA
CATATTCCTGGAATGCAATGACCAGTCCGTGCAGCCTCGGCGGCGCCAACACTTTCAGTACGATCTTCCCATAGA
GCTGACTGGCCTGTTGCGCTCTGGGGAAAACTCGGTTCGAGTCAGCTTACCTCGGGTCGGAAATGGTGACCAGGA
TTGGACCTATTTCATGGGAGTGGAGGTAATCAAAACTCTGGACCACGATACCGTCCGTGCTATGGTTGAATCAAA
CTCTCGGACCAGCGCCGAGGAGACCAAGCGGAAAGTGAACCAGCGACTGAAGCAGGATGACTCCAACGATATCAT
CGCCCAGGACGAACACATTTGCGTGGCAGTGACGGATCCTTTTAGTTCTTCCCTCTTCACGACTCCTGTCCGAGG
AGCGGATTGCAAACATTTGGAATGCTTCGACCTGGATATTTGGCTGCGAACTCGCCCAGGAAGACACTCAGGCTC
CGGGAACAAGCACGAACCGAGCACGGCCGATTGCTGGAAATGTCCTATTTGTGATCTCGACGCGAGACCCGTCTG
CCTCCACATCGACGACTTCTTCACGGAGGTGCGCGCAAAGCTCGTTGAGGACGGCGAAGACGCCATAAAAAAAAT
TAGCATTCAACCTGATGGAACCTGGAGCCCGCTGCCGGAAGCCGACGAGGCCGAAGAGGCGGTGATGTCGCCCGC
CACGTCCGGCCACGAGCGGCCCGGTCTCCCGCAGGCAGCGCGCTCGGCATCAGTGCAGGCGATTGTCATCGACGA
TGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail