Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5268
Gene name
Locationscaffold_426:14095..16391
Strand+
Gene length (bp)2296
Transcript length (bp)1956
Coding sequence length (bp)1953
Protein length (aa) 651

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01545 Cation_efflux Cation efflux family 2.3E-46 275 541

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HGQ3|CIS4_SCHPO Probable zinc transporter cis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cis4 PE=1 SV=1 261 635 7.0E-66
sp|Q8R4H9|ZNT5_MOUSE Zinc transporter 5 OS=Mus musculus GN=Slc30a5 PE=1 SV=1 262 649 4.0E-56
sp|Q8TAD4|ZNT5_HUMAN Zinc transporter 5 OS=Homo sapiens GN=SLC30A5 PE=1 SV=1 262 649 9.0E-56
sp|Q28CE7|ZNT5_XENTR Zinc transporter 5 OS=Xenopus tropicalis GN=slc30a5 PE=2 SV=1 262 649 2.0E-54
sp|A4IFD7|ZNT7_BOVIN Zinc transporter 7 OS=Bos taurus GN=SLC30A7 PE=2 SV=1 264 617 3.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HGQ3|CIS4_SCHPO Probable zinc transporter cis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cis4 PE=1 SV=1 261 635 7.0E-66
sp|Q8R4H9|ZNT5_MOUSE Zinc transporter 5 OS=Mus musculus GN=Slc30a5 PE=1 SV=1 262 649 4.0E-56
sp|Q8TAD4|ZNT5_HUMAN Zinc transporter 5 OS=Homo sapiens GN=SLC30A5 PE=1 SV=1 262 649 9.0E-56
sp|Q28CE7|ZNT5_XENTR Zinc transporter 5 OS=Xenopus tropicalis GN=slc30a5 PE=2 SV=1 262 649 2.0E-54
sp|A4IFD7|ZNT7_BOVIN Zinc transporter 7 OS=Bos taurus GN=SLC30A7 PE=2 SV=1 264 617 3.0E-47
sp|Q8NEW0|ZNT7_HUMAN Zinc transporter 7 OS=Homo sapiens GN=SLC30A7 PE=2 SV=1 264 617 1.0E-46
sp|Q8H329|MTP8_ORYSJ Metal tolerance protein 8 OS=Oryza sativa subsp. japonica GN=MTP8 PE=2 SV=2 260 624 7.0E-45
sp|Q5MNV6|ZNT7_CHICK Zinc transporter 7 OS=Gallus gallus GN=SLC30A7 PE=2 SV=1 264 617 8.0E-43
sp|Q6P3N9|ZNT7_XENTR Zinc transporter 7 OS=Xenopus tropicalis GN=slc30a7 PE=2 SV=1 262 588 3.0E-41
sp|Q6NRI1|ZNT7B_XENLA Zinc transporter 7-B OS=Xenopus laevis GN=slc30a7-b PE=2 SV=1 262 588 2.0E-40
sp|Q9JKN1|ZNT7_MOUSE Zinc transporter 7 OS=Mus musculus GN=Slc30a7 PE=1 SV=1 264 617 7.0E-40
sp|Q52KD7|ZNT7A_XENLA Zinc transporter 7-A OS=Xenopus laevis GN=slc30a7-a PE=2 SV=1 262 588 3.0E-39
sp|Q5BJM8|ZNT7_RAT Zinc transporter 7 OS=Rattus norvegicus GN=Slc30a7 PE=2 SV=2 264 617 7.0E-39
sp|A5PMX1|ZNT7_DANRE Zinc transporter 7 OS=Danio rerio GN=slc30a7 PE=2 SV=1 264 624 5.0E-36
sp|O13918|ZHF1_SCHPO Zinc homeostasis factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zhf1 PE=2 SV=3 273 624 1.0E-34
sp|Q5ZLF4|ZNT5_CHICK Zinc transporter 5 OS=Gallus gallus GN=SLC30A5 PE=2 SV=1 262 407 1.0E-32
sp|Q6DG36|ZNT5_DANRE Zinc transporter 5 OS=Danio rerio GN=slc30a5 PE=2 SV=1 262 407 3.0E-32
sp|Q54F34|Y1141_DICDI Probable zinc transporter protein DDB_G0291141 OS=Dictyostelium discoideum GN=DDB_G0291141 PE=3 SV=1 261 396 5.0E-29
sp|P20107|ZRC1_YEAST Zinc/cadmium resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRC1 PE=1 SV=2 266 545 3.0E-28
sp|Q03455|MSC2_YEAST Probable zinc transporter MSC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSC2 PE=1 SV=2 267 407 1.0E-24
sp|Q9SI03|MTP12_ARATH Metal tolerance protein 12 OS=Arabidopsis thaliana GN=MTP12 PE=3 SV=1 260 394 1.0E-24
sp|P32798|COT1_YEAST Cobalt uptake protein COT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COT1 PE=1 SV=2 273 628 1.0E-22
sp|Q3UVU3|ZNT10_MOUSE Zinc transporter 10 OS=Mus musculus GN=Slc30a10 PE=1 SV=1 273 624 2.0E-20
sp|Q95QW4|CDF1_CAEEL Cation diffusion facilitator family protein 1 OS=Caenorhabditis elegans GN=cdf-1 PE=1 SV=1 271 617 4.0E-19
sp|Q6XR72|ZNT10_HUMAN Zinc transporter 10 OS=Homo sapiens GN=SLC30A10 PE=1 SV=2 268 625 6.0E-19
sp|Q03455|MSC2_YEAST Probable zinc transporter MSC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSC2 PE=1 SV=2 470 648 9.0E-17
sp|Q4R6K2|ZNT1_MACFA Zinc transporter 1 OS=Macaca fascicularis GN=SLC30A1 PE=2 SV=1 273 619 5.0E-16
sp|Q9Y6M5|ZNT1_HUMAN Zinc transporter 1 OS=Homo sapiens GN=SLC30A1 PE=1 SV=3 273 619 7.0E-16
sp|Q62720|ZNT1_RAT Zinc transporter 1 OS=Rattus norvegicus GN=Slc30a1 PE=2 SV=1 273 619 3.0E-15
sp|Q60738|ZNT1_MOUSE Zinc transporter 1 OS=Mus musculus GN=Slc30a1 PE=1 SV=1 273 619 9.0E-15
sp|O07084|CZCD_BACSU Cadmium, cobalt and zinc/H(+)-K(+) antiporter OS=Bacillus subtilis (strain 168) GN=czcD PE=1 SV=1 284 391 6.0E-14
sp|Q55E98|Y9332_DICDI Probable zinc transporter protein DDB_G0269332 OS=Dictyostelium discoideum GN=DDB_G0269332 PE=3 SV=1 254 396 7.0E-14
sp|A7Z1S6|CZCD_BACMF Cadmium, cobalt and zinc/H(+)-K(+) antiporter OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=czcD PE=3 SV=1 284 391 8.0E-14
sp|Q8X400|ZITB_ECO57 Zinc transporter ZitB OS=Escherichia coli O157:H7 GN=zitB PE=3 SV=1 269 398 2.0E-12
sp|Q9M271|MTPA1_ARATH Metal tolerance protein A1 OS=Arabidopsis thaliana GN=MTPA1 PE=2 SV=1 272 615 3.0E-12
sp|P75757|ZITB_ECOLI Zinc transporter ZitB OS=Escherichia coli (strain K12) GN=zitB PE=1 SV=1 268 405 4.0E-12
sp|Q83SA2|ZITB_SHIFL Zinc transporter ZitB OS=Shigella flexneri GN=zitB PE=3 SV=1 268 405 4.0E-12
sp|Q66D85|ZITB_YERPS Zinc transporter ZitB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=zitB PE=3 SV=1 270 390 7.0E-12
sp|Q8ZGY6|ZITB_YERPE Zinc transporter ZitB OS=Yersinia pestis GN=zitB PE=3 SV=1 270 390 8.0E-12
sp|Q6ICY4|MTPC2_ARATH Metal tolerance protein C2 OS=Arabidopsis thaliana GN=MTPC2 PE=2 SV=1 268 409 2.0E-11
sp|Q8Z8B6|ZITB_SALTI Zinc transporter ZitB OS=Salmonella typhi GN=zitB PE=3 SV=1 269 390 2.0E-11
sp|Q6DBM8|MTPB_ARATH Metal tolerance protein B OS=Arabidopsis thaliana GN=MTPB PE=2 SV=1 269 397 8.0E-11
sp|Q8ZQT3|ZITB_SALTY Zinc transporter ZitB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=zitB PE=3 SV=1 269 390 3.0E-10
sp|Q9ZT63|MTP1_ARATH Metal tolerance protein 1 OS=Arabidopsis thaliana GN=MTP1 PE=1 SV=2 268 391 5.0E-10
sp|Q9SI03|MTP12_ARATH Metal tolerance protein 12 OS=Arabidopsis thaliana GN=MTP12 PE=3 SV=1 483 624 7.0E-10
sp|O14863|ZNT4_HUMAN Zinc transporter 4 OS=Homo sapiens GN=SLC30A4 PE=2 SV=2 269 391 8.0E-10
sp|Q2HJ10|ZNT2_MOUSE Zinc transporter 2 OS=Mus musculus GN=Slc30a2 PE=2 SV=1 272 416 1.0E-09
sp|Q688R1|MTP1_ORYSJ Metal tolerance protein 1 OS=Oryza sativa subsp. japonica GN=MTP1 PE=2 SV=1 272 391 2.0E-09
sp|O35149|ZNT4_MOUSE Zinc transporter 4 OS=Mus musculus GN=Slc30a4 PE=1 SV=2 269 600 3.0E-09
sp|O55174|ZNT4_RAT Zinc transporter 4 OS=Rattus norvegicus GN=Slc30a4 PE=2 SV=1 269 600 3.0E-09
sp|Q54QU8|Y3629_DICDI Probable zinc transporter protein DDB_G0283629 OS=Dictyostelium discoideum GN=DDB_G0283629 PE=3 SV=1 266 396 6.0E-09
sp|Q9LXS1|MTPA2_ARATH Metal tolerance protein A2 OS=Arabidopsis thaliana GN=MTPA2 PE=2 SV=2 272 390 1.0E-08
sp|Q99726|ZNT3_HUMAN Zinc transporter 3 OS=Homo sapiens GN=SLC30A3 PE=1 SV=2 272 640 1.0E-08
sp|Q5R617|ZNT3_PONAB Zinc transporter 3 OS=Pongo abelii GN=SLC30A3 PE=2 SV=1 272 640 1.0E-08
sp|C0SP78|YDFM_BACSU Uncharacterized transporter YdfM OS=Bacillus subtilis (strain 168) GN=ydfM PE=3 SV=1 278 379 3.0E-08
sp|Q5XHB4|ZNT8_XENTR Zinc transporter 8 OS=Xenopus tropicalis GN=slc30a8 PE=2 SV=1 280 420 3.0E-08
sp|Q54T06|Y8206_DICDI Probable zinc transporter protein DDB_G0282067 OS=Dictyostelium discoideum GN=DDB_G0282067 PE=2 SV=1 279 397 8.0E-08
sp|Q5I020|ZNT8_XENLA Zinc transporter 8 OS=Xenopus laevis GN=slc30a8 PE=2 SV=1 280 420 2.0E-07
sp|Q08E25|ZNT3_BOVIN Zinc transporter 3 OS=Bos taurus GN=SLC30A3 PE=2 SV=1 269 640 2.0E-07
sp|Q54T06|Y8206_DICDI Probable zinc transporter protein DDB_G0282067 OS=Dictyostelium discoideum GN=DDB_G0282067 PE=2 SV=1 455 617 4.0E-07
sp|Q6QIX3|ZNT3_RAT Zinc transporter 3 OS=Rattus norvegicus GN=Slc30a3 PE=1 SV=1 268 640 6.0E-07
sp|O07084|CZCD_BACSU Cadmium, cobalt and zinc/H(+)-K(+) antiporter OS=Bacillus subtilis (strain 168) GN=czcD PE=1 SV=1 477 549 1.0E-06
sp|P0CE46|ZNT8_RAT Zinc transporter 8 OS=Rattus norvegicus GN=Slc30a8 PE=1 SV=1 280 406 4.0E-06
sp|Q6D7E5|ZITB_PECAS Zinc transporter ZitB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=zitB PE=3 SV=1 268 398 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0006812 cation transport Yes
GO:0008324 cation transmembrane transporter activity Yes
GO:0015075 ion transmembrane transporter activity No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0022857 transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0006811 ion transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.5

Transmembrane Domains

Domain # Start End Length
1 275 294 19
2 299 321 22
3 341 363 22
4 375 397 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5268
MPCVAQPGTNGCHMGTKSGLPQLFFLFYLFLSLSRAPYSLASSAKEESSPFFRRRFSYLPTYLGLSVGPRAVSAL
PRSLSAGPTSFRHRGLESRRKQRYIKTAKISCGRRPAFGRTGPPDGHATPLNLWRASMSRDSHAEDEFRGRDRTP
TRSSQPHTRVSSQASNTSATLSREKPPPPPLDSLDGWTHERTAGGKHVLTPAQGRAMTAPYSPPKHSHDDGGHGH
DECHDDGDARATGQESKHARSLLTRVLLGYTIRFPILHAILVSKDSRRIFYFMTLNFCFMTVQAFYGYLTDSLGL
LSDSIHMFFDCVALLVGLLAAVMSKWPPSQRFPYGFGKIETLSGFANGILLMLLSVEIIFEAFERLWEGTPTKRL
GELFLVSCMGLGVNLVGMMAFGHHHHHGHDHGHHGHDHGHHGHSHDHTHEKCHGSHDAHDASASPGPASGSPGHG
HGHGHSHGHSHGHGHSHSHSHSHGHGDNDNMHGIYLHVLADTLGSVSVIVSTALTSIWGWSGWDPLASCLIATLI
FLSSKPLVLSSARRLLLSVPEEAEYRLRSTLGGILQQRGVASYSAPKLWLNDGGDRTTTTRLVGVVHVAVARGAS
LDETRERVRDYLSREGIDAVVQTERDGDYGCWCAKSRGGPMTPRMSKPMYE
Coding >Ophio5|5268
ATGCCGTGTGTGGCGCAGCCCGGCACTAACGGTTGCCACATGGGGACTAAGTCTGGTCTGCCTCAGCTTTTCTTT
CTTTTTTATCTCTTCCTCAGCCTGTCTCGGGCCCCTTACTCGCTCGCCAGCTCGGCCAAGGAGGAGTCATCGCCA
TTCTTTCGTCGTCGCTTCTCTTACCTACCTACCTACCTAGGTCTTTCTGTCGGACCACGTGCCGTCTCCGCTCTC
CCGCGCTCGCTCTCCGCTGGACCGACTTCGTTTCGACATCGCGGCCTCGAATCCCGACGAAAACAAAGATATATA
AAGACGGCGAAAATCTCGTGCGGGCGTCGACCCGCTTTCGGGAGAACAGGTCCTCCCGATGGCCACGCCACGCCG
CTCAATCTCTGGCGTGCCTCCATGTCACGAGACTCGCACGCCGAAGATGAGTTCCGCGGCCGAGATCGCACGCCA
ACTCGCTCCTCGCAGCCGCACACCCGGGTCAGCTCCCAGGCCTCGAATACGAGCGCCACCCTTTCGCGCGAAAAG
CCGCCGCCGCCGCCGCTCGACTCGCTCGATGGATGGACACACGAGAGGACGGCTGGCGGCAAGCATGTCCTGACA
CCTGCGCAGGGCCGTGCCATGACGGCGCCGTACTCGCCGCCCAAGCATTCTCACGACGACGGGGGCCACGGCCAT
GATGAGTGCCACGACGATGGTGACGCGCGCGCTACCGGCCAAGAGTCGAAGCACGCTCGGTCTCTGTTGACCAGA
GTCCTCCTCGGTTACACCATCCGCTTTCCCATACTCCATGCCATTCTGGTCAGCAAAGACTCGAGACGCATCTTT
TACTTTATGACACTCAACTTTTGCTTCATGACGGTGCAAGCGTTTTACGGCTACCTGACGGATTCGCTGGGCCTG
CTGAGCGACAGCATTCACATGTTCTTCGACTGCGTCGCCTTGCTCGTCGGGCTGCTGGCGGCCGTCATGAGTAAG
TGGCCGCCGAGCCAGAGGTTTCCCTACGGCTTCGGCAAGATTGAGACGCTGAGCGGCTTCGCCAACGGCATACTC
TTGATGCTGTTGAGCGTCGAGATTATCTTTGAGGCCTTTGAACGGCTGTGGGAGGGGACGCCGACCAAGAGGCTG
GGCGAGCTGTTTCTCGTCAGTTGCATGGGCTTGGGCGTCAACTTGGTGGGCATGATGGCGTTTGGGCATCACCAT
CATCACGGGCACGATCATGGGCATCACGGGCACGACCATGGGCACCACGGGCACAGCCATGACCACACACACGAA
AAATGCCACGGCAGCCACGACGCTCACGACGCCTCGGCGAGCCCCGGCCCGGCCTCCGGCTCTCCCGGGCACGGC
CACGGCCACGGCCACAGTCACGGCCACAGTCACGGCCACGGCCACAGCCACAGCCACAGCCACAGCCACGGCCAC
GGCGACAACGACAACATGCACGGCATCTACCTGCACGTGTTGGCCGACACACTCGGCAGCGTGTCCGTCATCGTC
TCGACGGCACTGACGAGCATATGGGGATGGAGCGGGTGGGATCCGCTGGCGTCGTGCCTAATCGCCACGCTCATC
TTCCTATCGTCGAAGCCGCTGGTTCTCTCGTCTGCACGGCGGCTACTCCTCAGCGTGCCGGAAGAGGCCGAGTAC
CGACTGCGGAGCACGCTGGGCGGCATCCTACAGCAGCGCGGCGTGGCGAGCTACTCAGCACCCAAGCTGTGGCTC
AACGACGGCGGCGACAGGACCACGACGACGAGGCTCGTCGGCGTCGTTCACGTGGCTGTTGCTCGAGGCGCGTCC
CTGGACGAGACGCGTGAGAGAGTGCGCGACTATCTGTCGCGGGAGGGCATCGACGCGGTGGTGCAGACGGAGCGG
GATGGGGACTACGGCTGCTGGTGTGCAAAGAGCAGGGGGGGGCCGATGACGCCGCGCATGTCGAAGCCGATGTAC
GAA
Transcript >Ophio5|5268
ATGCCGTGTGTGGCGCAGCCCGGCACTAACGGTTGCCACATGGGGACTAAGTCTGGTCTGCCTCAGCTTTTCTTT
CTTTTTTATCTCTTCCTCAGCCTGTCTCGGGCCCCTTACTCGCTCGCCAGCTCGGCCAAGGAGGAGTCATCGCCA
TTCTTTCGTCGTCGCTTCTCTTACCTACCTACCTACCTAGGTCTTTCTGTCGGACCACGTGCCGTCTCCGCTCTC
CCGCGCTCGCTCTCCGCTGGACCGACTTCGTTTCGACATCGCGGCCTCGAATCCCGACGAAAACAAAGATATATA
AAGACGGCGAAAATCTCGTGCGGGCGTCGACCCGCTTTCGGGAGAACAGGTCCTCCCGATGGCCACGCCACGCCG
CTCAATCTCTGGCGTGCCTCCATGTCACGAGACTCGCACGCCGAAGATGAGTTCCGCGGCCGAGATCGCACGCCA
ACTCGCTCCTCGCAGCCGCACACCCGGGTCAGCTCCCAGGCCTCGAATACGAGCGCCACCCTTTCGCGCGAAAAG
CCGCCGCCGCCGCCGCTCGACTCGCTCGATGGATGGACACACGAGAGGACGGCTGGCGGCAAGCATGTCCTGACA
CCTGCGCAGGGCCGTGCCATGACGGCGCCGTACTCGCCGCCCAAGCATTCTCACGACGACGGGGGCCACGGCCAT
GATGAGTGCCACGACGATGGTGACGCGCGCGCTACCGGCCAAGAGTCGAAGCACGCTCGGTCTCTGTTGACCAGA
GTCCTCCTCGGTTACACCATCCGCTTTCCCATACTCCATGCCATTCTGGTCAGCAAAGACTCGAGACGCATCTTT
TACTTTATGACACTCAACTTTTGCTTCATGACGGTGCAAGCGTTTTACGGCTACCTGACGGATTCGCTGGGCCTG
CTGAGCGACAGCATTCACATGTTCTTCGACTGCGTCGCCTTGCTCGTCGGGCTGCTGGCGGCCGTCATGAGTAAG
TGGCCGCCGAGCCAGAGGTTTCCCTACGGCTTCGGCAAGATTGAGACGCTGAGCGGCTTCGCCAACGGCATACTC
TTGATGCTGTTGAGCGTCGAGATTATCTTTGAGGCCTTTGAACGGCTGTGGGAGGGGACGCCGACCAAGAGGCTG
GGCGAGCTGTTTCTCGTCAGTTGCATGGGCTTGGGCGTCAACTTGGTGGGCATGATGGCGTTTGGGCATCACCAT
CATCACGGGCACGATCATGGGCATCACGGGCACGACCATGGGCACCACGGGCACAGCCATGACCACACACACGAA
AAATGCCACGGCAGCCACGACGCTCACGACGCCTCGGCGAGCCCCGGCCCGGCCTCCGGCTCTCCCGGGCACGGC
CACGGCCACGGCCACAGTCACGGCCACAGTCACGGCCACGGCCACAGCCACAGCCACAGCCACAGCCACGGCCAC
GGCGACAACGACAACATGCACGGCATCTACCTGCACGTGTTGGCCGACACACTCGGCAGCGTGTCCGTCATCGTC
TCGACGGCACTGACGAGCATATGGGGATGGAGCGGGTGGGATCCGCTGGCGTCGTGCCTAATCGCCACGCTCATC
TTCCTATCGTCGAAGCCGCTGGTTCTCTCGTCTGCACGGCGGCTACTCCTCAGCGTGCCGGAAGAGGCCGAGTAC
CGACTGCGGAGCACGCTGGGCGGCATCCTACAGCAGCGCGGCGTGGCGAGCTACTCAGCACCCAAGCTGTGGCTC
AACGACGGCGGCGACAGGACCACGACGACGAGGCTCGTCGGCGTCGTTCACGTGGCTGTTGCTCGAGGCGCGTCC
CTGGACGAGACGCGTGAGAGAGTGCGCGACTATCTGTCGCGGGAGGGCATCGACGCGGTGGTGCAGACGGAGCGG
GATGGGGACTACGGCTGCTGGTGTGCAAAGAGCAGGGGGGGGCCGATGACGCCGCGCATGTCGAAGCCGATGTAC
GAATAG
Gene >Ophio5|5268
ATGCCGTGTGTGGCGCAGCCCGGCACTAACGGTTGCCACATGGGGACTAAGGTACGGCCCGGGTTGCGCTGGAAG
AGGCGCTGTCTCGCCGCCTGGAAGAAAGCCGGTCAGGCCAATGCAAGCCCCTGCGTCGGCCAGGCCACGATTGAC
GAATCAGAGCCCGTGTCGTAGTCTGGTCTGCCTCAGCTTTTCTTTCTTTTTTATCTCTTCCTCAGCCTGTCTCGG
GCCCCTTACTCGCTCGCCAGCTCGGCCAAGGAGGAGTCATCGCCATTCTTTCGTCGTCGCTTCTCTTACCTACCT
ACCTACCTAGGTCTTTCTGTCGGACCACGTGCCGTCTCCGCTCTCCCGCGCTCGCTCTCCGCTGGACCGACTTCG
TTTCGACATCGCGGCCTCGAATCCCGACGGTACCCCCTTCCCCTCCCCGTCGACGTTCGATCCTGTCTCCTCGGC
GACCAGCAGGTAACCACGAACCAAAGAAAACAAAGATATATAAAGACGGCGAAAATCTCGTGCGGGCGTCGACCC
GCTTTCGGGAGAACAGGTCCTCCCGATGGCCACGCCGTATGCCCTGCCGTCCTCGGCACTGCATTCGCATCCGCA
GACGCCGCTCAATCTCTGGCGTGCCTCCATGTCACGAGACTCGCACGCCGAAGATGAGTTCCGCGGCCGAGATCG
CACGCCAACTCGCTCCTCGCAGCCGCACACCCGGGTCAGCTCCCAGGCCTCGAATACGAGCGCCACCCTTTCGCG
CGAAAAGCCGCCGCCGCCGCCGCTCGACTCGCTCGATGGATGGACACACGAGAGGACGGCTGGCGGCAAGCATGT
CCTGACACCTGCGCAGGGCCGTGCCATGACGGCGCCGTACTCGCCGCCCAAGCATTCTCACGACGACGGGGGCCA
CGGCCATGATGAGTGCCACGACGATGGTGACGCGCGCGCTACCGGCCAAGAGTCGAAGCACGCTCGGTCTCTGTT
GACCAGAGTCCTCCTCGGTTACACCATCCGCTTTCCCATACTCCATGCCATTCTGGTCAGCAAAGACTCGAGACG
CATCTTTTACTTTATGACGTGAGTCGTTTACTGTCACAACTTACACCACCTGGCTGACGCCTCGCCCATGACCAG
ACTCAACTTTTGCTTCATGACGGTGCAAGCGTTTTACGGCTACCTGACGGATTCGCTGGGCCTGCTGAGCGACAG
CATTCACATGTTCTTCGACTGCGTCGCCTTGCTCGTCGGGCTGCTGGCGGCCGTCATGAGTAAGTGGCCGCCGAG
CCAGAGGTTTCCCTACGGCTTCGGCAAGATTGAGACGCTGAGCGGCTTCGCCAACGGCATACTCTTGATGTGAGT
CGGTACGGCTGACGGGAGCTTGCGAGGATGCTGATGGCGGCGCAGGCTGTTGAGCGTCGAGATTATCTTTGAGGC
CTTTGAACGGCTGTGGGAGGGGACGCCGACCAAGAGGCTGGGCGAGCTGTTTCTCGTCAGTTGCATGGGCTTGGG
CGTCAACTTGGTGGGCATGATGGCGTTTGGGCATCACCATCATCACGGGCACGATCATGGGCATCACGGGCACGA
CCATGGGCACCACGGGCACAGCCATGACCACACACACGAAAAATGCCACGGCAGCCACGACGCTCACGACGCCTC
GGCGAGCCCCGGCCCGGCCTCCGGCTCTCCCGGGCACGGCCACGGCCACGGCCACAGTCACGGCCACAGTCACGG
CCACGGCCACAGCCACAGCCACAGCCACAGCCACGGCCACGGCGACAACGACAACATGCACGGCATCTACCTGCA
CGTGTTGGCCGACACACTCGGCAGCGTGTCCGTCATCGTCTCGACGGCACTGACGAGCATATGGGGATGGAGCGG
GTGGGATCCGCTGGCGTCGTGCCTAATCGCCACGCTCATCTTCCTATCGTCGAAGCCGCTGGTTCTCTCGTCTGC
ACGGCGGCTACTCCTCAGCGTGCCGGAAGAGGCCGAGTACCGACTGCGGAGCACGCTGGGCGGCATCCTACAGCA
GCGCGGCGTGGCGAGCTACTCAGCACCCAAGCTGTGGCTCAACGACGGCGGCGACAGGACCACGACGACGAGGCT
CGTCGGCGTCGTTCACGTGGCTGTTGCTCGAGGCGCGTCCCTGGACGAGACGCGTGAGAGAGTGCGCGACTATCT
GTCGCGGGAGGGCATCGACGCGGTGGTGCAGACGGAGCGGGATGGGGACTACGGCTGCTGGTGTGCAAAGAGCAG
GGGGGGGCCGATGACGCCGCGCATGTCGAAGCCGATGTACGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail