Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5253
Gene name
Locationscaffold_425:6393..8895
Strand+
Gene length (bp)2502
Transcript length (bp)2283
Coding sequence length (bp)2280
Protein length (aa) 760

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13854 Kelch_5 Kelch motif 1.3E-12 331 379
PF13415 Kelch_3 Galactose oxidase, central domain 1.1E-04 353 398

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AYG1|KLDC1_ARTBC Kelch repeat-containing protein ARB_01230 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01230 PE=1 SV=1 8 473 5.0E-22

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 527 549 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5253
MRPHRRSLLLSLVVSQAGRTVAQFNNWQDHQINTTICYWKQPRAALIRDTVYLDGGDIWWSPGLDSGSVAAPSNQ
GNFQGIILTYNLSDPFTPITNTTGLLLKRPLFKARGGRANGISSEPNAVDGAILANDAEFFLYGGALLRNDVLYR
QPAADAVLEYQAFKYGLDKPLLQEGFREARLDEGVTRYLAYGGAASAPSENKAWYFSGLTSPSRGPIFSNPSING
STRAMNISNTLITVDMTTQLREKWSNATLPPSVKGRSNAEVVWVPVGKQGILVVLGGVTYPEWASAIHKSEDEAA
STRESPAFMRLIDIYDVASGRWYQQPTTAGPGARARGCAVVAPASDYSSFNIYYYGGFDGIHPRSRFYDDVWVLS
LPSFTWTQISTGTEIHARAGHRCFLPYPDQMMVFGGYAAEAGDLPSCLDKGPVVVFNISSGEWMNSYDPSRYDPY
GVHEEVLATIGGEASGGATVTAPRTSGWATPELGRVFAEKYDRGKIKTYWPYQTNAMTGRVELPSTPQDGNDSHK
RIIIPAVLVPLVVLAGVAILAWRCWVRRRRSQGSSSGDSEEAAVRIRSWVRGQATSKSLTMTSSGAVSPEPDMAS
AYPLSPDGVTPSTHHEMADTQVAELADTSPPLELHDTGLTPLEVIQKHTSFGPNKLRSPSDPSRSSLSGPGDNNS
FVSQTSGAAHSGLLDSPLLGCNPPLDLSPRPKPASDSRRSLPAMMEEPIQGSVSRPVEGDSSTGGTVPVKKSVFR
ENVGDDVSPK
Coding >Ophio5|5253
ATGCGGCCTCACAGAAGAAGTTTGCTCCTGAGCCTCGTCGTGTCGCAGGCGGGCCGGACCGTCGCCCAATTCAAT
AACTGGCAGGACCATCAGATCAACACCACCATCTGCTATTGGAAGCAACCCAGAGCGGCCTTGATTCGTGACACC
GTCTATCTCGATGGAGGCGACATCTGGTGGTCCCCCGGCCTCGACTCAGGCTCCGTCGCCGCGCCCTCCAACCAA
GGCAACTTCCAAGGCATCATCCTAACCTACAACCTAAGCGACCCCTTCACCCCCATCACCAACACTACGGGCCTG
CTCCTCAAGAGACCGCTGTTCAAAGCCCGCGGCGGGCGCGCCAACGGCATCAGCTCCGAGCCCAACGCCGTCGAC
GGTGCCATACTCGCCAATGACGCCGAGTTCTTTCTGTACGGAGGCGCCCTGCTGCGCAACGACGTCTTGTATCGA
CAGCCCGCCGCTGATGCCGTGCTCGAGTATCAAGCCTTCAAGTATGGCCTTGACAAGCCGCTGCTGCAGGAGGGA
TTTCGCGAAGCGAGACTGGACGAGGGCGTCACGCGCTATCTCGCCTACGGGGGAGCGGCCAGCGCGCCTTCGGAG
AATAAGGCCTGGTACTTTTCTGGCTTGACTTCGCCCTCTCGCGGCCCCATCTTTTCTAACCCGAGCATCAACGGG
TCGACGCGCGCCATGAACATCTCCAACACTCTCATCACGGTGGACATGACCACCCAGCTGAGGGAGAAGTGGAGC
AACGCTACCCTGCCGCCGTCCGTCAAGGGCCGCTCCAACGCCGAAGTCGTCTGGGTCCCCGTCGGCAAGCAGGGC
ATCCTCGTCGTCCTCGGCGGCGTGACATATCCCGAGTGGGCTTCCGCCATTCACAAGTCCGAGGACGAAGCGGCA
AGCACACGAGAGAGCCCGGCCTTTATGCGCCTCATCGACATCTACGACGTAGCCAGCGGCCGCTGGTATCAGCAG
CCGACGACGGCCGGTCCCGGCGCGCGCGCAAGGGGCTGTGCCGTCGTAGCGCCCGCTTCAGACTATTCCAGCTTC
AACATCTATTACTATGGCGGCTTCGACGGCATCCATCCGCGAAGTCGCTTCTACGACGATGTCTGGGTCCTCTCC
CTCCCGTCCTTCACCTGGACCCAGATCAGCACGGGCACCGAGATACACGCCCGCGCGGGCCATCGCTGTTTCTTG
CCGTACCCCGACCAGATGATGGTCTTTGGTGGTTACGCCGCTGAGGCGGGCGACCTCCCCTCGTGCCTCGACAAG
GGCCCGGTTGTCGTCTTTAACATCTCCAGCGGAGAGTGGATGAACTCGTACGACCCGTCGAGATACGACCCGTAC
GGCGTACATGAAGAGGTCCTGGCTACCATCGGAGGCGAAGCGTCGGGAGGCGCCACGGTAACGGCGCCGAGGACG
TCGGGCTGGGCCACGCCGGAGTTGGGCCGTGTCTTCGCAGAAAAGTACGACAGAGGCAAGATCAAGACCTACTGG
CCCTACCAGACAAACGCCATGACCGGCCGCGTCGAGCTTCCCAGCACCCCCCAGGATGGCAACGACAGCCATAAA
CGCATCATTATCCCCGCCGTGCTTGTGCCCCTCGTCGTCCTTGCCGGCGTGGCCATCCTGGCATGGCGGTGCTGG
GTGAGACGTCGCCGTTCACAGGGCAGCTCCTCTGGGGACTCGGAGGAGGCGGCAGTGCGGATTCGATCCTGGGTC
AGGGGTCAAGCAACCAGCAAGTCGCTGACCATGACGAGCTCGGGTGCCGTATCGCCAGAGCCGGACATGGCGTCC
GCTTACCCCTTGTCCCCTGATGGTGTCACCCCGTCGACTCACCACGAGATGGCCGACACGCAGGTGGCCGAGCTG
GCAGACACGTCGCCGCCCCTCGAGCTGCATGACACAGGCCTCACCCCCCTGGAGGTGATACAGAAGCACACGAGC
TTCGGGCCTAATAAGCTGCGCTCCCCCTCCGACCCCTCCCGCAGCTCCCTCTCGGGCCCGGGCGACAACAACAGC
TTCGTGTCACAGACGTCGGGGGCGGCACACAGCGGCCTGCTGGACTCGCCCCTACTGGGCTGCAACCCGCCGCTG
GATCTCAGCCCCAGGCCCAAACCCGCAAGCGACTCGAGACGTTCGCTGCCAGCCATGATGGAGGAGCCGATTCAG
GGTTCCGTGTCCCGGCCGGTCGAGGGAGATTCGTCGACTGGCGGGACCGTCCCGGTCAAGAAGAGTGTCTTTCGT
GAGAATGTGGGGGACGACGTCAGCCCCAAG
Transcript >Ophio5|5253
ATGCGGCCTCACAGAAGAAGTTTGCTCCTGAGCCTCGTCGTGTCGCAGGCGGGCCGGACCGTCGCCCAATTCAAT
AACTGGCAGGACCATCAGATCAACACCACCATCTGCTATTGGAAGCAACCCAGAGCGGCCTTGATTCGTGACACC
GTCTATCTCGATGGAGGCGACATCTGGTGGTCCCCCGGCCTCGACTCAGGCTCCGTCGCCGCGCCCTCCAACCAA
GGCAACTTCCAAGGCATCATCCTAACCTACAACCTAAGCGACCCCTTCACCCCCATCACCAACACTACGGGCCTG
CTCCTCAAGAGACCGCTGTTCAAAGCCCGCGGCGGGCGCGCCAACGGCATCAGCTCCGAGCCCAACGCCGTCGAC
GGTGCCATACTCGCCAATGACGCCGAGTTCTTTCTGTACGGAGGCGCCCTGCTGCGCAACGACGTCTTGTATCGA
CAGCCCGCCGCTGATGCCGTGCTCGAGTATCAAGCCTTCAAGTATGGCCTTGACAAGCCGCTGCTGCAGGAGGGA
TTTCGCGAAGCGAGACTGGACGAGGGCGTCACGCGCTATCTCGCCTACGGGGGAGCGGCCAGCGCGCCTTCGGAG
AATAAGGCCTGGTACTTTTCTGGCTTGACTTCGCCCTCTCGCGGCCCCATCTTTTCTAACCCGAGCATCAACGGG
TCGACGCGCGCCATGAACATCTCCAACACTCTCATCACGGTGGACATGACCACCCAGCTGAGGGAGAAGTGGAGC
AACGCTACCCTGCCGCCGTCCGTCAAGGGCCGCTCCAACGCCGAAGTCGTCTGGGTCCCCGTCGGCAAGCAGGGC
ATCCTCGTCGTCCTCGGCGGCGTGACATATCCCGAGTGGGCTTCCGCCATTCACAAGTCCGAGGACGAAGCGGCA
AGCACACGAGAGAGCCCGGCCTTTATGCGCCTCATCGACATCTACGACGTAGCCAGCGGCCGCTGGTATCAGCAG
CCGACGACGGCCGGTCCCGGCGCGCGCGCAAGGGGCTGTGCCGTCGTAGCGCCCGCTTCAGACTATTCCAGCTTC
AACATCTATTACTATGGCGGCTTCGACGGCATCCATCCGCGAAGTCGCTTCTACGACGATGTCTGGGTCCTCTCC
CTCCCGTCCTTCACCTGGACCCAGATCAGCACGGGCACCGAGATACACGCCCGCGCGGGCCATCGCTGTTTCTTG
CCGTACCCCGACCAGATGATGGTCTTTGGTGGTTACGCCGCTGAGGCGGGCGACCTCCCCTCGTGCCTCGACAAG
GGCCCGGTTGTCGTCTTTAACATCTCCAGCGGAGAGTGGATGAACTCGTACGACCCGTCGAGATACGACCCGTAC
GGCGTACATGAAGAGGTCCTGGCTACCATCGGAGGCGAAGCGTCGGGAGGCGCCACGGTAACGGCGCCGAGGACG
TCGGGCTGGGCCACGCCGGAGTTGGGCCGTGTCTTCGCAGAAAAGTACGACAGAGGCAAGATCAAGACCTACTGG
CCCTACCAGACAAACGCCATGACCGGCCGCGTCGAGCTTCCCAGCACCCCCCAGGATGGCAACGACAGCCATAAA
CGCATCATTATCCCCGCCGTGCTTGTGCCCCTCGTCGTCCTTGCCGGCGTGGCCATCCTGGCATGGCGGTGCTGG
GTGAGACGTCGCCGTTCACAGGGCAGCTCCTCTGGGGACTCGGAGGAGGCGGCAGTGCGGATTCGATCCTGGGTC
AGGGGTCAAGCAACCAGCAAGTCGCTGACCATGACGAGCTCGGGTGCCGTATCGCCAGAGCCGGACATGGCGTCC
GCTTACCCCTTGTCCCCTGATGGTGTCACCCCGTCGACTCACCACGAGATGGCCGACACGCAGGTGGCCGAGCTG
GCAGACACGTCGCCGCCCCTCGAGCTGCATGACACAGGCCTCACCCCCCTGGAGGTGATACAGAAGCACACGAGC
TTCGGGCCTAATAAGCTGCGCTCCCCCTCCGACCCCTCCCGCAGCTCCCTCTCGGGCCCGGGCGACAACAACAGC
TTCGTGTCACAGACGTCGGGGGCGGCACACAGCGGCCTGCTGGACTCGCCCCTACTGGGCTGCAACCCGCCGCTG
GATCTCAGCCCCAGGCCCAAACCCGCAAGCGACTCGAGACGTTCGCTGCCAGCCATGATGGAGGAGCCGATTCAG
GGTTCCGTGTCCCGGCCGGTCGAGGGAGATTCGTCGACTGGCGGGACCGTCCCGGTCAAGAAGAGTGTCTTTCGT
GAGAATGTGGGGGACGACGTCAGCCCCAAGTGA
Gene >Ophio5|5253
ATGCGGCCTCACAGAAGAAGTTTGCTCCTGAGCCTCGTCGTGTCGCAGGCGGGCCGGACCGTCGCCCAATTCAAT
AACTGGCAGGACCATCAGATCAACACCACCATCTGCTATTGGAAGCAACCCAGAGGTGGGCATCAAGTCACTCTT
CTAGCAATAACCAGCTGACGATCCCTCAGCGGCCTTGATTCGTGACACCGTCTATCTCGATGGAGGCGACATCTG
GTGGTCCCCCGGCCTCGACTCAGGCTCCGTCGCCGCGCCCTCCAACCAAGGTTCCGTCAACCTCAACTCACTTCA
CATTCCCCAACCACTGACAACCGCCAGGCAACTTCCAAGGCATCATCCTAACCTACAACCTAAGCGACCCCTTCA
CCCCCATCACCAACACTACGGGCCTGCTCCTCAAGAGACCGCTGTTCAAAGCCCGCGGCGGGCGCGCCAACGGCA
TCAGCTCCGAGCCCAACGCCGTCGACGGTGCCATACTCGCCAATGACGCCGAGTTCTTTCTGTACGGAGGCGCCC
TGCTGCGCAACGACGTCTTGTATCGACAGCCCGCCGCTGATGCCGTGCTCGAGTATCAAGCCTTCAAGTATGGCC
TTGACAAGCCGCTGCTGCAGGAGGGATTTCGCGAAGCGAGACTGGACGAGGGCGTCACGCGCTATCTCGCCTACG
GGGGAGCGGCCAGCGCGCCTTCGGAGAATAAGGCCTGGTACTTTTCTGGCTTGACTTCGCCCTCTCGCGGCCCCA
TCTTTTCTAACCCGAGCATCAACGGGTCGACGCGCGCCATGAACATCTCCAACACTCTCATCACGGTGGACATGA
CCACCCAGCTGAGGGAGAAGTGGAGCAACGCTACCCTGCCGCCGTCCGTCAAGGGCCGCTCCAACGCCGAAGTCG
TCTGGGTCCCCGTCGGCAAGCAGGGCATCCTCGTCGTCCTCGGCGGCGTGACATATCCCGAGTGGGCTTCCGCCA
TTCACAAGTCCGAGGACGAAGCGGCAAGCGTAAGCGCGCCAAGAGAAAAAAAAAACGATACCATGGCAGCTTGGG
CGCTGACGGGACTGCCAGACACGAGAGAGCCCGGCCTTTATGCGCCTCATCGACATCTACGACGTAGCCAGCGGC
CGCTGGTATCAGCAGCCGACGACGGCCGGTCCCGGCGCGCGCGCAAGGGGCTGTGCCGTCGTAGCGCCCGCTTCA
GACTATTCCAGCTTCAACATCTATTACTATGGCGGCTTCGACGGCATCCATCCGCGAAGTCGCTTCTACGACGAT
GTCTGGGTCCTCTCCCTCCCGTCCTTCACCTGGACCCAGATCAGCACGGGCACCGAGATACACGCCCGCGCGGGC
CATCGCTGTTTCTTGCCGTACCCCGACCAGATGATGGTCTTTGGTGGTTACGCCGCTGAGGCGGGCGACCTCCCC
TCGTGCCTCGACAAGGGCCCGGTTGTCGTCTTTAACATCTCCAGCGGAGAGTGGATGAACTCGTACGACCCGTCG
AGATACGACCCGTACGGCGTACATGAAGAGGTCCTGGCTACCATCGGAGGCGAAGCGTCGGGAGGCGCCACGGTA
ACGGCGCCGAGGACGTCGGGCTGGGCCACGCCGGAGTTGGGCCGTGTCTTCGCAGAAAAGTACGACAGAGGCAAG
ATCAAGACCTACTGGCCCTACCAGACAAACGCCATGACCGGCCGCGTCGAGCTTCCCAGCACCCCCCAGGATGGC
AACGACAGCCATAAACGCATCATTATCCCCGCCGTGCTTGTGCCCCTCGTCGTCCTTGCCGGCGTGGCCATCCTG
GCATGGCGGTGCTGGGTGAGACGTCGCCGTTCACAGGGCAGCTCCTCTGGGGACTCGGAGGAGGCGGCAGTGCGG
ATTCGATCCTGGGTCAGGGGTCAAGCAACCAGCAAGTCGCTGACCATGACGAGCTCGGGTGCCGTATCGCCAGAG
CCGGACATGGCGTCCGCTTACCCCTTGTCCCCTGATGGTGTCACCCCGTCGACTCACCACGAGATGGCCGACACG
CAGGTGGCCGAGCTGGCAGGTGAGTTTTGCTGCGGCTGCGTTCCCGAGCATGACCGCTGACAGGTCATGACAGAC
ACGTCGCCGCCCCTCGAGCTGCATGACACAGGCCTCACCCCCCTGGAGGTGATACAGAAGCACACGAGCTTCGGG
CCTAATAAGCTGCGCTCCCCCTCCGACCCCTCCCGCAGCTCCCTCTCGGGCCCGGGCGACAACAACAGCTTCGTG
TCACAGACGTCGGGGGCGGCACACAGCGGCCTGCTGGACTCGCCCCTACTGGGCTGCAACCCGCCGCTGGATCTC
AGCCCCAGGCCCAAACCCGCAAGCGACTCGAGACGTTCGCTGCCAGCCATGATGGAGGAGCCGATTCAGGGTTCC
GTGTCCCGGCCGGTCGAGGGAGATTCGTCGACTGGCGGGACCGTCCCGGTCAAGAAGAGTGTCTTTCGTGAGAAT
GTGGGGGACGACGTCAGCCCCAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail