Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5240
Gene name
Locationscaffold_423:5337..7013
Strand+
Gene length (bp)1676
Transcript length (bp)1551
Coding sequence length (bp)1548
Protein length (aa) 516

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09949 APP1_cat Phosphatidate phosphatase APP1, catalytic domain 1.8E-35 273 418

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008195 phosphatidate phosphatase activity Yes
GO:0016791 phosphatase activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0042578 phosphoric ester hydrolase activity No
GO:0003674 molecular_function No
GO:0016788 hydrolase activity, acting on ester bonds No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.0872 0.0479 0.7871 0.4555 0.0928 0.0102 0.2681 0.311 0.2153 0.0111

SignalP

SignalP signal predicted Location Score
Yes 1 - 29 0.893478

Transmembrane Domains

Domain # Start End Length
1 492 514 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 197.72 96.77 298.68
CcL In ants, during behavior modification 146.46 67.35 225.56
CcD In ants, recently dead 64.14 34.80 93.48

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.262626 no
SC16a CcD 0.000286 yes
CcL CcD 0.000286 yes

Orthologs

Orthofinder run ID4
Orthogroup6030
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|05774
Ophiocordyceps camponoti-rufipedis Ophun1|6941
Ophiocordyceps kimflemingae Ophio5|5240 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1199

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5240
MLRFVASASVLAVVASSGPVSTPSSTPIPSATESIATPTPTPTLKIEARGLKDIQSYVSSLAAGGASKISSFVQS
GILDFPLGFPTGTNVEKSASVSASAVEAQPTEVLNLPPYANWTDEGWNVRVHGNVFKTPNISQDKIDTLANAFLI
GVDVDQLQPPEQAQARNLTRSIFIFQQGDKSVTMDFVNDVAVRPNASGGAVNADGGAQTIPLPFNTTAQGDFDVF
VKLKNTTSPSGRGLIAGNETSRIQTLNLYAQGTDTGNATAYLVPPQGVTIISDIDDILRVTKIYQPKEGLLNTFA
RPFEAWMNMPQIYANWSSSIPNMHFHYLTTTPEQGSRLYMDFIYKTYPLGSFDTRPLNFSDLKATLSIRKFLLDK
VFQTFPQRKFILVADTSNRDVMKDYPQMYKDHPEQVLCILLRNTSATDPSDRFPYDTSGFRDIPQEHYMFFTVPD
DLAGLNVLGSQCLNQSVRQNVTFRTQGLPSWLSVDESNARRARGAVGIAVGAWLAALATTVFLGML
Coding >Ophio5|5240
ATGCTGCGGTTTGTCGCCTCGGCGTCGGTGCTCGCCGTCGTTGCGTCGTCCGGCCCGGTGTCGACGCCCTCCTCA
ACTCCGATTCCCTCGGCGACCGAGTCGATAGCGACGCCGACGCCGACGCCGACTCTCAAGATTGAGGCACGCGGC
CTCAAGGACATCCAGAGCTACGTGTCGAGCCTGGCGGCCGGTGGGGCCAGTAAAATCTCTTCCTTTGTCCAGTCG
GGCATCCTCGACTTTCCCTTGGGCTTTCCTACCGGCACCAATGTGGAGAAATCTGCCAGCGTTTCGGCATCTGCC
GTCGAAGCGCAGCCGACCGAGGTGTTGAATCTACCCCCGTATGCCAACTGGACCGACGAGGGCTGGAACGTGCGC
GTTCATGGCAACGTATTCAAGACGCCGAACATCTCGCAGGATAAGATTGACACGCTCGCCAATGCCTTCCTGATC
GGAGTCGACGTCGACCAGCTGCAGCCGCCTGAGCAGGCTCAAGCCAGGAACTTGACGCGTTCCATCTTCATCTTT
CAGCAGGGCGACAAGAGCGTCACCATGGACTTTGTCAACGACGTGGCTGTGCGGCCAAACGCGTCTGGGGGTGCT
GTCAACGCTGACGGCGGCGCGCAGACGATCCCATTGCCTTTTAACACGACGGCTCAGGGCGACTTCGACGTCTTC
GTCAAGCTGAAGAACACGACGAGTCCCAGCGGCCGAGGCCTGATAGCAGGCAACGAAACGTCGCGCATACAGACT
CTCAACCTGTACGCCCAGGGCACCGACACCGGCAACGCAACGGCATACCTCGTCCCTCCACAGGGCGTCACCATC
ATCTCCGACATCGACGACATCCTGCGCGTCACCAAAATCTATCAACCAAAAGAAGGCCTCCTTAACACGTTCGCG
CGGCCCTTTGAAGCGTGGATGAACATGCCGCAGATATACGCCAACTGGTCGTCCTCGATCCCAAACATGCACTTC
CACTACCTGACGACGACACCCGAGCAAGGGTCGCGCCTCTACATGGACTTCATCTACAAGACTTATCCTCTAGGT
TCCTTTGATACGCGGCCGCTCAACTTCTCTGACCTGAAAGCGACGCTATCGATTCGCAAGTTTCTGCTCGACAAG
GTGTTCCAGACCTTTCCGCAGCGCAAGTTCATTCTCGTCGCCGACACGTCCAACCGCGACGTCATGAAGGACTAT
CCACAGATGTACAAGGACCATCCCGAGCAGGTGCTGTGCATCTTGTTACGGAACACGAGCGCGACGGACCCGTCG
GACAGGTTTCCCTACGACACGTCGGGCTTCCGCGACATCCCGCAAGAGCATTACATGTTCTTTACCGTGCCGGAC
GACCTCGCCGGGTTGAATGTGCTTGGCTCCCAATGTCTCAACCAGTCGGTGCGGCAGAATGTCACCTTTCGGACG
CAGGGCCTGCCCTCTTGGCTGAGCGTCGATGAGAGCAACGCACGGCGGGCGAGGGGGGCGGTTGGCATCGCGGTT
GGGGCCTGGCTGGCGGCTTTGGCGACGACGGTGTTTTTGGGGATGCTG
Transcript >Ophio5|5240
ATGCTGCGGTTTGTCGCCTCGGCGTCGGTGCTCGCCGTCGTTGCGTCGTCCGGCCCGGTGTCGACGCCCTCCTCA
ACTCCGATTCCCTCGGCGACCGAGTCGATAGCGACGCCGACGCCGACGCCGACTCTCAAGATTGAGGCACGCGGC
CTCAAGGACATCCAGAGCTACGTGTCGAGCCTGGCGGCCGGTGGGGCCAGTAAAATCTCTTCCTTTGTCCAGTCG
GGCATCCTCGACTTTCCCTTGGGCTTTCCTACCGGCACCAATGTGGAGAAATCTGCCAGCGTTTCGGCATCTGCC
GTCGAAGCGCAGCCGACCGAGGTGTTGAATCTACCCCCGTATGCCAACTGGACCGACGAGGGCTGGAACGTGCGC
GTTCATGGCAACGTATTCAAGACGCCGAACATCTCGCAGGATAAGATTGACACGCTCGCCAATGCCTTCCTGATC
GGAGTCGACGTCGACCAGCTGCAGCCGCCTGAGCAGGCTCAAGCCAGGAACTTGACGCGTTCCATCTTCATCTTT
CAGCAGGGCGACAAGAGCGTCACCATGGACTTTGTCAACGACGTGGCTGTGCGGCCAAACGCGTCTGGGGGTGCT
GTCAACGCTGACGGCGGCGCGCAGACGATCCCATTGCCTTTTAACACGACGGCTCAGGGCGACTTCGACGTCTTC
GTCAAGCTGAAGAACACGACGAGTCCCAGCGGCCGAGGCCTGATAGCAGGCAACGAAACGTCGCGCATACAGACT
CTCAACCTGTACGCCCAGGGCACCGACACCGGCAACGCAACGGCATACCTCGTCCCTCCACAGGGCGTCACCATC
ATCTCCGACATCGACGACATCCTGCGCGTCACCAAAATCTATCAACCAAAAGAAGGCCTCCTTAACACGTTCGCG
CGGCCCTTTGAAGCGTGGATGAACATGCCGCAGATATACGCCAACTGGTCGTCCTCGATCCCAAACATGCACTTC
CACTACCTGACGACGACACCCGAGCAAGGGTCGCGCCTCTACATGGACTTCATCTACAAGACTTATCCTCTAGGT
TCCTTTGATACGCGGCCGCTCAACTTCTCTGACCTGAAAGCGACGCTATCGATTCGCAAGTTTCTGCTCGACAAG
GTGTTCCAGACCTTTCCGCAGCGCAAGTTCATTCTCGTCGCCGACACGTCCAACCGCGACGTCATGAAGGACTAT
CCACAGATGTACAAGGACCATCCCGAGCAGGTGCTGTGCATCTTGTTACGGAACACGAGCGCGACGGACCCGTCG
GACAGGTTTCCCTACGACACGTCGGGCTTCCGCGACATCCCGCAAGAGCATTACATGTTCTTTACCGTGCCGGAC
GACCTCGCCGGGTTGAATGTGCTTGGCTCCCAATGTCTCAACCAGTCGGTGCGGCAGAATGTCACCTTTCGGACG
CAGGGCCTGCCCTCTTGGCTGAGCGTCGATGAGAGCAACGCACGGCGGGCGAGGGGGGCGGTTGGCATCGCGGTT
GGGGCCTGGCTGGCGGCTTTGGCGACGACGGTGTTTTTGGGGATGCTGTAG
Gene >Ophio5|5240
ATGCTGCGGTTTGTCGCCTCGGCGTCGGTGCTCGCCGTCGTTGCGTCGTCCGGCCCGGTGTCGACGCCCTCCTCA
ACTCCGATTCCCTCGGCGACCGAGTCGATAGCGACGCCGACGCCGACGCCGACTCTCAAGATTGAGGCACGCGGC
CTCAAGGACATCCAGAGCTACGTGTCGAGCCTGGCGGCCGGTGGGGCCAGTAAAATCTCTTCCTTTGTCCAGTCG
GGCATCCTCGACTTTCCCTTGGGCTTTCCTACCGGCACCAATGTGGAGAAATCTGCCAGCGTTTCGGCATCTGCC
GTCGAAGCGCAGCCGACCGAGGTGTTGAATCTACCGTGAGTATCTCCAATCTCTGCAGACGACCATGACATAACG
CGAAGCGTATCTGTCAGCCCGTATGCCAACTGGACCGACGAGGGCTGGAACGTGCGCGTTCATGGCAACGTATTC
AAGACGCCGAACATCTCGCAGGATAAGATTGACACGCTCGCCAATGCCTTCCTGATCGGAGTCGACGTCGACCAG
CTGCAGCCGCCTGAGCAGGCTCAAGCCAGGAACTTGACGCGTTCCATCTTCATCTTTCAGCAGGGCGACAAGAGC
GTCACCATGGACTTTGTCAACGACGTGGCTGTGCGGCCAAACGCGTCTGGGGGTGCTGTCAACGCTGTGAGCCGT
CTTTCTAAACCTGATTTAAAAAAGGGGGGGGGGCTGCGGCTGACGAGAAAACCGATCAGGACGGCGGCGCGCAGA
CGATCCCATTGCCTTTTAACACGACGGCTCAGGGCGACTTCGACGTCTTCGTCAAGCTGAAGAACACGACGAGTC
CCAGCGGCCGAGGCCTGATAGCAGGCAACGAAACGTCGCGCATACAGACTCTCAACCTGTACGCCCAGGGCACCG
ACACCGGCAACGCAACGGCATACCTCGTCCCTCCACAGGGCGTCACCATCATCTCCGACATCGACGACATCCTGC
GCGTCACCAAAATCTATCAACCAAAAGAAGGCCTCCTTAACACGTTCGCGCGGCCCTTTGAAGCGTGGATGAACA
TGCCGCAGATATACGCCAACTGGTCGTCCTCGATCCCAAACATGCACTTCCACTACCTGACGACGACACCCGAGC
AAGGGTCGCGCCTCTACATGGACTTCATCTACAAGACTTATCCTCTAGGTTCCTTTGATACGCGGCCGCTCAACT
TCTCTGACCTGAAAGCGACGCTATCGATTCGCAAGTTTCTGCTCGACAAGGTGTTCCAGACCTTTCCGCAGCGCA
AGTTCATTCTCGTCGCCGACACGTCCAACCGCGACGTCATGAAGGACTATCCACAGATGTACAAGGACCATCCCG
AGCAGGTGCTGTGCATCTTGTTACGGAACACGAGCGCGACGGACCCGTCGGACAGGTTTCCCTACGACACGTCGG
GCTTCCGCGACATCCCGCAAGAGCATTACATGTTCTTTACCGTGCCGGACGACCTCGCCGGGTTGAATGTGCTTG
GCTCCCAATGTCTCAACCAGTCGGTGCGGCAGAATGTCACCTTTCGGACGCAGGGCCTGCCCTCTTGGCTGAGCG
TCGATGAGAGCAACGCACGGCGGGCGAGGGGGGCGGTTGGCATCGCGGTTGGGGCCTGGCTGGCGGCTTTGGCGA
CGACGGTGTTTTTGGGGATGCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail