Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5240
Gene name
Locationscaffold_423:5337..7013
Strand+
Gene length (bp)1676
Transcript length (bp)1551
Coding sequence length (bp)1548
Protein length (aa) 516

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09949 APP1_cat Phosphatidate phosphatase APP1, catalytic domain 1.8E-35 273 418

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008195 phosphatidate phosphatase activity Yes
GO:0016791 phosphatase activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0042578 phosphoric ester hydrolase activity No
GO:0003674 molecular_function No
GO:0016788 hydrolase activity, acting on ester bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 492 514 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5240
MLRFVASASVLAVVASSGPVSTPSSTPIPSATESIATPTPTPTLKIEARGLKDIQSYVSSLAAGGASKISSFVQS
GILDFPLGFPTGTNVEKSASVSASAVEAQPTEVLNLPPYANWTDEGWNVRVHGNVFKTPNISQDKIDTLANAFLI
GVDVDQLQPPEQAQARNLTRSIFIFQQGDKSVTMDFVNDVAVRPNASGGAVNADGGAQTIPLPFNTTAQGDFDVF
VKLKNTTSPSGRGLIAGNETSRIQTLNLYAQGTDTGNATAYLVPPQGVTIISDIDDILRVTKIYQPKEGLLNTFA
RPFEAWMNMPQIYANWSSSIPNMHFHYLTTTPEQGSRLYMDFIYKTYPLGSFDTRPLNFSDLKATLSIRKFLLDK
VFQTFPQRKFILVADTSNRDVMKDYPQMYKDHPEQVLCILLRNTSATDPSDRFPYDTSGFRDIPQEHYMFFTVPD
DLAGLNVLGSQCLNQSVRQNVTFRTQGLPSWLSVDESNARRARGAVGIAVGAWLAALATTVFLGML
Coding >Ophio5|5240
ATGCTGCGGTTTGTCGCCTCGGCGTCGGTGCTCGCCGTCGTTGCGTCGTCCGGCCCGGTGTCGACGCCCTCCTCA
ACTCCGATTCCCTCGGCGACCGAGTCGATAGCGACGCCGACGCCGACGCCGACTCTCAAGATTGAGGCACGCGGC
CTCAAGGACATCCAGAGCTACGTGTCGAGCCTGGCGGCCGGTGGGGCCAGTAAAATCTCTTCCTTTGTCCAGTCG
GGCATCCTCGACTTTCCCTTGGGCTTTCCTACCGGCACCAATGTGGAGAAATCTGCCAGCGTTTCGGCATCTGCC
GTCGAAGCGCAGCCGACCGAGGTGTTGAATCTACCCCCGTATGCCAACTGGACCGACGAGGGCTGGAACGTGCGC
GTTCATGGCAACGTATTCAAGACGCCGAACATCTCGCAGGATAAGATTGACACGCTCGCCAATGCCTTCCTGATC
GGAGTCGACGTCGACCAGCTGCAGCCGCCTGAGCAGGCTCAAGCCAGGAACTTGACGCGTTCCATCTTCATCTTT
CAGCAGGGCGACAAGAGCGTCACCATGGACTTTGTCAACGACGTGGCTGTGCGGCCAAACGCGTCTGGGGGTGCT
GTCAACGCTGACGGCGGCGCGCAGACGATCCCATTGCCTTTTAACACGACGGCTCAGGGCGACTTCGACGTCTTC
GTCAAGCTGAAGAACACGACGAGTCCCAGCGGCCGAGGCCTGATAGCAGGCAACGAAACGTCGCGCATACAGACT
CTCAACCTGTACGCCCAGGGCACCGACACCGGCAACGCAACGGCATACCTCGTCCCTCCACAGGGCGTCACCATC
ATCTCCGACATCGACGACATCCTGCGCGTCACCAAAATCTATCAACCAAAAGAAGGCCTCCTTAACACGTTCGCG
CGGCCCTTTGAAGCGTGGATGAACATGCCGCAGATATACGCCAACTGGTCGTCCTCGATCCCAAACATGCACTTC
CACTACCTGACGACGACACCCGAGCAAGGGTCGCGCCTCTACATGGACTTCATCTACAAGACTTATCCTCTAGGT
TCCTTTGATACGCGGCCGCTCAACTTCTCTGACCTGAAAGCGACGCTATCGATTCGCAAGTTTCTGCTCGACAAG
GTGTTCCAGACCTTTCCGCAGCGCAAGTTCATTCTCGTCGCCGACACGTCCAACCGCGACGTCATGAAGGACTAT
CCACAGATGTACAAGGACCATCCCGAGCAGGTGCTGTGCATCTTGTTACGGAACACGAGCGCGACGGACCCGTCG
GACAGGTTTCCCTACGACACGTCGGGCTTCCGCGACATCCCGCAAGAGCATTACATGTTCTTTACCGTGCCGGAC
GACCTCGCCGGGTTGAATGTGCTTGGCTCCCAATGTCTCAACCAGTCGGTGCGGCAGAATGTCACCTTTCGGACG
CAGGGCCTGCCCTCTTGGCTGAGCGTCGATGAGAGCAACGCACGGCGGGCGAGGGGGGCGGTTGGCATCGCGGTT
GGGGCCTGGCTGGCGGCTTTGGCGACGACGGTGTTTTTGGGGATGCTG
Transcript >Ophio5|5240
ATGCTGCGGTTTGTCGCCTCGGCGTCGGTGCTCGCCGTCGTTGCGTCGTCCGGCCCGGTGTCGACGCCCTCCTCA
ACTCCGATTCCCTCGGCGACCGAGTCGATAGCGACGCCGACGCCGACGCCGACTCTCAAGATTGAGGCACGCGGC
CTCAAGGACATCCAGAGCTACGTGTCGAGCCTGGCGGCCGGTGGGGCCAGTAAAATCTCTTCCTTTGTCCAGTCG
GGCATCCTCGACTTTCCCTTGGGCTTTCCTACCGGCACCAATGTGGAGAAATCTGCCAGCGTTTCGGCATCTGCC
GTCGAAGCGCAGCCGACCGAGGTGTTGAATCTACCCCCGTATGCCAACTGGACCGACGAGGGCTGGAACGTGCGC
GTTCATGGCAACGTATTCAAGACGCCGAACATCTCGCAGGATAAGATTGACACGCTCGCCAATGCCTTCCTGATC
GGAGTCGACGTCGACCAGCTGCAGCCGCCTGAGCAGGCTCAAGCCAGGAACTTGACGCGTTCCATCTTCATCTTT
CAGCAGGGCGACAAGAGCGTCACCATGGACTTTGTCAACGACGTGGCTGTGCGGCCAAACGCGTCTGGGGGTGCT
GTCAACGCTGACGGCGGCGCGCAGACGATCCCATTGCCTTTTAACACGACGGCTCAGGGCGACTTCGACGTCTTC
GTCAAGCTGAAGAACACGACGAGTCCCAGCGGCCGAGGCCTGATAGCAGGCAACGAAACGTCGCGCATACAGACT
CTCAACCTGTACGCCCAGGGCACCGACACCGGCAACGCAACGGCATACCTCGTCCCTCCACAGGGCGTCACCATC
ATCTCCGACATCGACGACATCCTGCGCGTCACCAAAATCTATCAACCAAAAGAAGGCCTCCTTAACACGTTCGCG
CGGCCCTTTGAAGCGTGGATGAACATGCCGCAGATATACGCCAACTGGTCGTCCTCGATCCCAAACATGCACTTC
CACTACCTGACGACGACACCCGAGCAAGGGTCGCGCCTCTACATGGACTTCATCTACAAGACTTATCCTCTAGGT
TCCTTTGATACGCGGCCGCTCAACTTCTCTGACCTGAAAGCGACGCTATCGATTCGCAAGTTTCTGCTCGACAAG
GTGTTCCAGACCTTTCCGCAGCGCAAGTTCATTCTCGTCGCCGACACGTCCAACCGCGACGTCATGAAGGACTAT
CCACAGATGTACAAGGACCATCCCGAGCAGGTGCTGTGCATCTTGTTACGGAACACGAGCGCGACGGACCCGTCG
GACAGGTTTCCCTACGACACGTCGGGCTTCCGCGACATCCCGCAAGAGCATTACATGTTCTTTACCGTGCCGGAC
GACCTCGCCGGGTTGAATGTGCTTGGCTCCCAATGTCTCAACCAGTCGGTGCGGCAGAATGTCACCTTTCGGACG
CAGGGCCTGCCCTCTTGGCTGAGCGTCGATGAGAGCAACGCACGGCGGGCGAGGGGGGCGGTTGGCATCGCGGTT
GGGGCCTGGCTGGCGGCTTTGGCGACGACGGTGTTTTTGGGGATGCTGTAG
Gene >Ophio5|5240
ATGCTGCGGTTTGTCGCCTCGGCGTCGGTGCTCGCCGTCGTTGCGTCGTCCGGCCCGGTGTCGACGCCCTCCTCA
ACTCCGATTCCCTCGGCGACCGAGTCGATAGCGACGCCGACGCCGACGCCGACTCTCAAGATTGAGGCACGCGGC
CTCAAGGACATCCAGAGCTACGTGTCGAGCCTGGCGGCCGGTGGGGCCAGTAAAATCTCTTCCTTTGTCCAGTCG
GGCATCCTCGACTTTCCCTTGGGCTTTCCTACCGGCACCAATGTGGAGAAATCTGCCAGCGTTTCGGCATCTGCC
GTCGAAGCGCAGCCGACCGAGGTGTTGAATCTACCGTGAGTATCTCCAATCTCTGCAGACGACCATGACATAACG
CGAAGCGTATCTGTCAGCCCGTATGCCAACTGGACCGACGAGGGCTGGAACGTGCGCGTTCATGGCAACGTATTC
AAGACGCCGAACATCTCGCAGGATAAGATTGACACGCTCGCCAATGCCTTCCTGATCGGAGTCGACGTCGACCAG
CTGCAGCCGCCTGAGCAGGCTCAAGCCAGGAACTTGACGCGTTCCATCTTCATCTTTCAGCAGGGCGACAAGAGC
GTCACCATGGACTTTGTCAACGACGTGGCTGTGCGGCCAAACGCGTCTGGGGGTGCTGTCAACGCTGTGAGCCGT
CTTTCTAAACCTGATTTAAAAAAGGGGGGGGGGCTGCGGCTGACGAGAAAACCGATCAGGACGGCGGCGCGCAGA
CGATCCCATTGCCTTTTAACACGACGGCTCAGGGCGACTTCGACGTCTTCGTCAAGCTGAAGAACACGACGAGTC
CCAGCGGCCGAGGCCTGATAGCAGGCAACGAAACGTCGCGCATACAGACTCTCAACCTGTACGCCCAGGGCACCG
ACACCGGCAACGCAACGGCATACCTCGTCCCTCCACAGGGCGTCACCATCATCTCCGACATCGACGACATCCTGC
GCGTCACCAAAATCTATCAACCAAAAGAAGGCCTCCTTAACACGTTCGCGCGGCCCTTTGAAGCGTGGATGAACA
TGCCGCAGATATACGCCAACTGGTCGTCCTCGATCCCAAACATGCACTTCCACTACCTGACGACGACACCCGAGC
AAGGGTCGCGCCTCTACATGGACTTCATCTACAAGACTTATCCTCTAGGTTCCTTTGATACGCGGCCGCTCAACT
TCTCTGACCTGAAAGCGACGCTATCGATTCGCAAGTTTCTGCTCGACAAGGTGTTCCAGACCTTTCCGCAGCGCA
AGTTCATTCTCGTCGCCGACACGTCCAACCGCGACGTCATGAAGGACTATCCACAGATGTACAAGGACCATCCCG
AGCAGGTGCTGTGCATCTTGTTACGGAACACGAGCGCGACGGACCCGTCGGACAGGTTTCCCTACGACACGTCGG
GCTTCCGCGACATCCCGCAAGAGCATTACATGTTCTTTACCGTGCCGGACGACCTCGCCGGGTTGAATGTGCTTG
GCTCCCAATGTCTCAACCAGTCGGTGCGGCAGAATGTCACCTTTCGGACGCAGGGCCTGCCCTCTTGGCTGAGCG
TCGATGAGAGCAACGCACGGCGGGCGAGGGGGGCGGTTGGCATCGCGGTTGGGGCCTGGCTGGCGGCTTTGGCGA
CGACGGTGTTTTTGGGGATGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail