Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5229
Gene name
Locationscaffold_421:14015..15673
Strand-
Gene length (bp)1658
Transcript length (bp)1521
Coding sequence length (bp)1518
Protein length (aa) 506

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08643 DUF1776 Fungal family of unknown function (DUF1776) 3.5E-96 130 436

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9URV8|YBL3_SCHPO UPF0744 protein C106.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC106.03 PE=1 SV=1 24 379 3.0E-16

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5229
MSADDQHFLDLLSGIPVHLRHYSSEAADYVDRSIDRASSSLRDILAASAWIPDSIKPNPVVRPSTSAASAAASAA
VSRFELARRWVARHKIVTGLFLVVCGTVAFKGYQDSRRRWPRKVRRAKRARNGGRVDVVVVAGSPTLPLTKSLSL
DLEKRGFVVFVVCNAAEDENMVHAFSRPDIRPLTIDTTDPPRAGAAIERFASYLQSPQATGPQIKPNQLTLKSVI
LIPSLHYQTSPIATIPPSSFADLFNTHLLQPILTIQAFLPLLTSRLNPVGEKWIPPKVLVFTPSIISSINPPFHA
PEATVCSALAAFTEVLAAELRPLDIPVTHVQLGTFDFSSFSAPGRSFVPLAPGTPHDTLVWPDGARHVYGRNFVA
QTTSAVSGGRIRDFKGSSLRYLHTTVFDVIDGSITSHSVRVGLGAGIYGFVGRWAPRSLVSWMMGIRRVDELSTW
KASLEDAAGGCSPCDEGEDSATALSQEFIAVPSERNVWNTDTADSSLWVPSVSETS
Coding >Ophio5|5229
ATGTCCGCCGACGATCAACACTTTCTCGACTTGCTTTCCGGCATCCCCGTTCACCTACGCCACTACTCGAGTGAG
GCCGCCGATTATGTTGACCGAAGTATCGACCGCGCTTCCTCGTCTCTGCGCGATATTCTGGCCGCCTCTGCGTGG
ATTCCAGACTCGATAAAGCCAAATCCAGTCGTCAGGCCGTCTACTTCGGCTGCCAGTGCTGCTGCCTCGGCCGCC
GTGTCGCGCTTCGAGCTGGCTCGTCGTTGGGTGGCGCGTCACAAGATTGTCACGGGCCTCTTCCTCGTCGTCTGC
GGCACCGTTGCGTTCAAAGGCTATCAAGACAGTCGCCGTCGCTGGCCTCGTAAGGTCCGAAGAGCAAAAAGGGCG
CGTAACGGCGGCCGCGTCGATGTCGTCGTCGTCGCCGGTTCGCCTACACTGCCCCTGACTAAGTCGCTTTCTCTC
GACTTGGAGAAGCGCGGCTTCGTCGTCTTTGTTGTTTGCAATGCCGCCGAGGATGAGAACATGGTGCATGCCTTT
TCGCGCCCGGATATACGGCCTCTTACCATCGACACCACCGACCCCCCCCGCGCCGGCGCCGCCATCGAGCGCTTC
GCCAGCTATCTGCAGTCGCCGCAGGCTACCGGTCCCCAGATCAAGCCGAATCAGCTGACTCTCAAGTCGGTCATC
CTCATTCCCAGCCTCCACTACCAGACGTCGCCCATCGCCACGATACCGCCCTCGAGCTTCGCCGACCTCTTCAAC
ACCCATCTCCTGCAGCCCATTCTAACCATCCAGGCCTTCCTCCCACTGCTCACGTCGCGACTGAACCCCGTCGGA
GAGAAATGGATCCCGCCCAAGGTCCTCGTCTTCACGCCGTCCATCATCTCCTCCATCAACCCGCCCTTCCACGCC
CCCGAGGCCACCGTCTGCTCGGCCCTAGCCGCCTTCACCGAGGTGCTGGCCGCCGAGCTGCGCCCACTCGACATA
CCCGTCACCCACGTCCAGCTCGGCACCTTTGACTTTTCCAGCTTCTCCGCCCCGGGCCGGTCCTTCGTCCCGCTC
GCGCCAGGAACGCCCCACGACACGCTCGTGTGGCCCGACGGCGCGCGCCACGTCTACGGCCGCAATTTCGTGGCC
CAGACCACGTCGGCTGTCTCGGGCGGTCGCATCCGCGATTTCAAGGGCAGCTCGCTGCGTTATCTGCACACGACC
GTCTTCGACGTCATCGACGGCTCCATCACCAGCCACTCGGTTCGCGTCGGCCTCGGCGCCGGCATCTACGGCTTC
GTCGGCCGCTGGGCGCCCCGCAGCCTCGTCTCGTGGATGATGGGCATCCGTCGCGTCGACGAGCTGTCGACCTGG
AAGGCCAGCCTGGAGGATGCGGCTGGGGGGTGCTCGCCTTGCGACGAGGGCGAGGACTCGGCTACGGCGCTGTCC
CAAGAGTTCATCGCCGTCCCGTCGGAGCGTAACGTCTGGAACACGGACACGGCTGATAGTAGCCTGTGGGTACCG
TCGGTATCCGAGACGTCG
Transcript >Ophio5|5229
ATGTCCGCCGACGATCAACACTTTCTCGACTTGCTTTCCGGCATCCCCGTTCACCTACGCCACTACTCGAGTGAG
GCCGCCGATTATGTTGACCGAAGTATCGACCGCGCTTCCTCGTCTCTGCGCGATATTCTGGCCGCCTCTGCGTGG
ATTCCAGACTCGATAAAGCCAAATCCAGTCGTCAGGCCGTCTACTTCGGCTGCCAGTGCTGCTGCCTCGGCCGCC
GTGTCGCGCTTCGAGCTGGCTCGTCGTTGGGTGGCGCGTCACAAGATTGTCACGGGCCTCTTCCTCGTCGTCTGC
GGCACCGTTGCGTTCAAAGGCTATCAAGACAGTCGCCGTCGCTGGCCTCGTAAGGTCCGAAGAGCAAAAAGGGCG
CGTAACGGCGGCCGCGTCGATGTCGTCGTCGTCGCCGGTTCGCCTACACTGCCCCTGACTAAGTCGCTTTCTCTC
GACTTGGAGAAGCGCGGCTTCGTCGTCTTTGTTGTTTGCAATGCCGCCGAGGATGAGAACATGGTGCATGCCTTT
TCGCGCCCGGATATACGGCCTCTTACCATCGACACCACCGACCCCCCCCGCGCCGGCGCCGCCATCGAGCGCTTC
GCCAGCTATCTGCAGTCGCCGCAGGCTACCGGTCCCCAGATCAAGCCGAATCAGCTGACTCTCAAGTCGGTCATC
CTCATTCCCAGCCTCCACTACCAGACGTCGCCCATCGCCACGATACCGCCCTCGAGCTTCGCCGACCTCTTCAAC
ACCCATCTCCTGCAGCCCATTCTAACCATCCAGGCCTTCCTCCCACTGCTCACGTCGCGACTGAACCCCGTCGGA
GAGAAATGGATCCCGCCCAAGGTCCTCGTCTTCACGCCGTCCATCATCTCCTCCATCAACCCGCCCTTCCACGCC
CCCGAGGCCACCGTCTGCTCGGCCCTAGCCGCCTTCACCGAGGTGCTGGCCGCCGAGCTGCGCCCACTCGACATA
CCCGTCACCCACGTCCAGCTCGGCACCTTTGACTTTTCCAGCTTCTCCGCCCCGGGCCGGTCCTTCGTCCCGCTC
GCGCCAGGAACGCCCCACGACACGCTCGTGTGGCCCGACGGCGCGCGCCACGTCTACGGCCGCAATTTCGTGGCC
CAGACCACGTCGGCTGTCTCGGGCGGTCGCATCCGCGATTTCAAGGGCAGCTCGCTGCGTTATCTGCACACGACC
GTCTTCGACGTCATCGACGGCTCCATCACCAGCCACTCGGTTCGCGTCGGCCTCGGCGCCGGCATCTACGGCTTC
GTCGGCCGCTGGGCGCCCCGCAGCCTCGTCTCGTGGATGATGGGCATCCGTCGCGTCGACGAGCTGTCGACCTGG
AAGGCCAGCCTGGAGGATGCGGCTGGGGGGTGCTCGCCTTGCGACGAGGGCGAGGACTCGGCTACGGCGCTGTCC
CAAGAGTTCATCGCCGTCCCGTCGGAGCGTAACGTCTGGAACACGGACACGGCTGATAGTAGCCTGTGGGTACCG
TCGGTATCCGAGACGTCGTAA
Gene >Ophio5|5229
ATGTCCGCCGACGATCAACACTTTCTCGACTTGGTTTGTTGCCCCCTCCCGTTCTTGGGAATTTTTTTTTCCCCA
TCTTATTTGTTTCTGACTGATGGATCTTGTCCAGCTTTCCGGCATCCCCGTTCACCTACGCCACTACTCGAGTGA
GGCCGCCGATTATGTTGACCGAAGTATCGACCGCGCTTCCTCGTCTCTGCGCGATATTCTGGCCGCCTCTGCGTG
GATTCCAGACTCGATAAAGCCAAATCCAGTCGTCAGGCCGTCTACTTCGGCTGCCAGTGCTGCTGCCTCGGCCGC
CGTGTCGCGCTTCGAGCTGGCTCGTCGTTGGGTGGCGCGTCACAAGATTGTCACGGGCCTCTTCCTCGTCGTCTG
CGGCACCGTTGCGTTCAAAGGCTATCAAGACAGTCGCCGTCGCTGGCCTCGTAAGGTCCGAAGAGCAAAAAGGGC
GCGTAACGGCGGCCGCGTCGATGTCGTCGTCGTCGCCGGTTCGCCTACACTGCCCCTGACTAAGTCGCTTTCTCT
CGACTTGGAGAAGCGCGGCTTCGTCGTCTTTGTTGTTTGCAATGCCGCCGAGGATGAGAACATGGTGCATGCCTT
TTCGCGCCCGGATATACGGCCTCTTACCATCGACACCACCGACGTGCGTCCTCTTCCCCTTCAGCACAAACAACG
TCTTTGTTTTGCTAAACTCCTCCGTCCAGCCCCCCCGCGCCGGCGCCGCCATCGAGCGCTTCGCCAGCTATCTGC
AGTCGCCGCAGGCTACCGGTCCCCAGATCAAGCCGAATCAGCTGACTCTCAAGTCGGTCATCCTCATTCCCAGCC
TCCACTACCAGACGTCGCCCATCGCCACGATACCGCCCTCGAGCTTCGCCGACCTCTTCAACACCCATCTCCTGC
AGCCCATTCTAACCATCCAGGCCTTCCTCCCACTGCTCACGTCGCGACTGAACCCCGTCGGAGAGAAATGGATCC
CGCCCAAGGTCCTCGTCTTCACGCCGTCCATCATCTCCTCCATCAACCCGCCCTTCCACGCCCCCGAGGCCACCG
TCTGCTCGGCCCTAGCCGCCTTCACCGAGGTGCTGGCCGCCGAGCTGCGCCCACTCGACATACCCGTCACCCACG
TCCAGCTCGGCACCTTTGACTTTTCCAGCTTCTCCGCCCCGGGCCGGTCCTTCGTCCCGCTCGCGCCAGGAACGC
CCCACGACACGCTCGTGTGGCCCGACGGCGCGCGCCACGTCTACGGCCGCAATTTCGTGGCCCAGACCACGTCGG
CTGTCTCGGGCGGTCGCATCCGCGATTTCAAGGGCAGCTCGCTGCGTTATCTGCACACGACCGTCTTCGACGTCA
TCGACGGCTCCATCACCAGCCACTCGGTTCGCGTCGGCCTCGGCGCCGGCATCTACGGCTTCGTCGGCCGCTGGG
CGCCCCGCAGCCTCGTCTCGTGGATGATGGGCATCCGTCGCGTCGACGAGCTGTCGACCTGGAAGGCCAGCCTGG
AGGATGCGGCTGGGGGGTGCTCGCCTTGCGACGAGGGCGAGGACTCGGCTACGGCGCTGTCCCAAGAGTTCATCG
CCGTCCCGTCGGAGCGTAACGTCTGGAACACGGACACGGCTGATAGTAGCCTGTGGGTACCGTCGGTATCCGAGA
CGTCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail