Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5225
Gene name
Locationscaffold_421:4811..5293
Strand-
Gene length (bp)482
Transcript length (bp)441
Coding sequence length (bp)438
Protein length (aa) 146

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5405 0.5004 0.32 0.0852 0.3908 0.0591 0.3468 0.2601 0.2326 0.2598

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5972
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|05082
Ophiocordyceps camponoti-rufipedis Ophun1|2126
Ophiocordyceps camponoti-rufipedis Ophun1|2856
Ophiocordyceps kimflemingae Ophio5|5203
Ophiocordyceps kimflemingae Ophio5|5224
Ophiocordyceps kimflemingae Ophio5|5225 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5225
MLHFEDCFIDAVQHPVQLLDRTDEAGQNLRTGSFSTRHEVDEYIDSYRDAYRSRFMCDSLFLSLFSLHLSCTYTS
ISICQSNSWQPLQATHSMLSALVTAHDLGDTFWDLASCFYRRNDEFEQAYFVPFTRSITGSWIRSSLPDTG
Coding >Ophio5|5225
ATGCTACACTTCGAAGACTGCTTCATCGACGCGGTGCAGCATCCGGTGCAACTTCTGGACCGCACCGACGAAGCG
GGCCAGAATCTGCGCACCGGCAGCTTCTCTACTAGGCATGAAGTCGACGAATACATTGACTCGTACCGCGATGCG
TACCGTAGCCGCTTCATGTGCGACTCTCTCTTTCTCTCCCTCTTTTCTCTTCATCTCTCATGCACATATACATCC
ATATCCATCTGTCAGAGTAACTCGTGGCAGCCGCTCCAGGCCACGCATTCTATGCTCTCCGCCCTCGTCACCGCT
CACGACCTTGGCGACACCTTCTGGGACCTGGCCTCGTGCTTCTACAGACGCAACGACGAGTTCGAGCAGGCCTAC
TTTGTACCATTTACCCGCTCCATCACCGGGTCTTGGATCCGTTCGTCTCTCCCTGATACTGGC
Transcript >Ophio5|5225
ATGCTACACTTCGAAGACTGCTTCATCGACGCGGTGCAGCATCCGGTGCAACTTCTGGACCGCACCGACGAAGCG
GGCCAGAATCTGCGCACCGGCAGCTTCTCTACTAGGCATGAAGTCGACGAATACATTGACTCGTACCGCGATGCG
TACCGTAGCCGCTTCATGTGCGACTCTCTCTTTCTCTCCCTCTTTTCTCTTCATCTCTCATGCACATATACATCC
ATATCCATCTGTCAGAGTAACTCGTGGCAGCCGCTCCAGGCCACGCATTCTATGCTCTCCGCCCTCGTCACCGCT
CACGACCTTGGCGACACCTTCTGGGACCTGGCCTCGTGCTTCTACAGACGCAACGACGAGTTCGAGCAGGCCTAC
TTTGTACCATTTACCCGCTCCATCACCGGGTCTTGGATCCGTTCGTCTCTCCCTGATACTGGCTAA
Gene >Ophio5|5225
ATGCTACACTTCGAAGACTGCTTCATCGACGCGGTGCAGCATCCGGTGCAACTTCTGGACCGCACCGACGAAGCG
GGCCAGAATCTGCGCACCGGCAGCTTCTCTACTAGGCATGAAGTCGACGAATACATTGACTCGTACCGCGATGCG
TACCGTAGCCGCTTCATGTGCGACTCTCTCTTTCTCTCCCTCTTTTCTCTTCATCTCTCATGCACATATACATCC
ATGTAGTATATTCGTCTGAGAACCTCACTCAATTTTGTGCCAGATCCATCTGTCAGAGTAACTCGTGGCAGCCGC
TCCAGGCCACGCATTCTATGCTCTCCGCCCTCGTCACCGCTCACGACCTTGGCGACACCTTCTGGGACCTGGCCT
CGTGCTTCTACAGACGCAACGACGAGTTCGAGCAGGCCTACTTTGTACCATTTACCCGCTCCATCACCGGGTCTT
GGATCCGTTCGTCTCTCCCTGATACTGGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail