Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5202
Gene name
Locationscaffold_42:27063..29469
Strand-
Gene length (bp)2406
Transcript length (bp)2406
Coding sequence length (bp)2403
Protein length (aa) 801

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08124 Lyase_8_N Polysaccharide lyase family 8, N terminal alpha-helical domain 9.0E-79 66 388
PF02278 Lyase_8 Polysaccharide lyase family 8, super-sandwich domain 5.5E-73 432 691
PF02884 Lyase_8_C Polysaccharide lyase family 8, C-terminal beta-sandwich domain 9.4E-08 704 760

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9AQS0|XANLY_BACGL Xanthan lyase OS=Bacillus sp. (strain GL1) GN=xly PE=1 SV=1 57 776 6.0E-107
sp|P0CZ01|HYSA_PROAC Hyaluronate lyase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=PPA0380 PE=3 SV=1 57 776 3.0E-99
sp|P0CZ00|HYSA_PROAA Hyaluronate lyase OS=Propionibacterium acnes PE=1 SV=1 57 776 1.0E-88
sp|Q54873|HYSA_STRPN Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=SP_0314 PE=1 SV=2 126 715 1.0E-73
sp|Q59801|HYSA_STAA8 Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325) GN=hysA PE=3 SV=1 59 716 3.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9AQS0|XANLY_BACGL Xanthan lyase OS=Bacillus sp. (strain GL1) GN=xly PE=1 SV=1 57 776 6.0E-107
sp|P0CZ01|HYSA_PROAC Hyaluronate lyase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=PPA0380 PE=3 SV=1 57 776 3.0E-99
sp|P0CZ00|HYSA_PROAA Hyaluronate lyase OS=Propionibacterium acnes PE=1 SV=1 57 776 1.0E-88
sp|Q54873|HYSA_STRPN Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=SP_0314 PE=1 SV=2 126 715 1.0E-73
sp|Q59801|HYSA_STAA8 Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325) GN=hysA PE=3 SV=1 59 716 3.0E-69
sp|Q53591|HYSA_STRA3 Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=hylB PE=1 SV=2 52 715 3.0E-66
sp|Q59288|CSLA_PEDHD Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / NCIB 9290) GN=cslA PE=1 SV=1 181 785 7.0E-32
[Show less]

GO

GO Term Description Terminal node
GO:0016829 lyase activity Yes
GO:0005576 extracellular region Yes
GO:0110165 cellular anatomical entity No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 3.10 0.89 5.31
CcL In ants, during behavior modification 14.86 6.71 23.01
CcD In ants, recently dead 22.70 11.68 33.72

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.096748 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5202
MRLDLLVTSLLALKSVNRALARPTTDEPNLALRRPSQRDWSTVDSAGNEKPTYASGDSFDRLRQRWRDMILGTDF
PAQSKPFKSLLLSLGRRAARFGDGFAPASGWLWPDLVYADAGAETTASQQSSAITKSFRRLLVMAHAWAQPGTGL
TGDSDLLSVILRGVDQLRRDVYNPSQEPFGNWWNWKIGIPDILMDLCAILYHQLGAERIADLVAANQHFVPGSAI
ASYLGSSTGANRISQCRSVVFSGIFGKSASRLFRARDALSPVFPPVTSGDGFYTDGSFIQHKSIPYTGTYGSVLI
NGVAKLTTLLAGSEWAVTDDRFQLLLDTVEKSFAPFIYNGLVMDGVSGRAVSRLSTDHTRGHSILESILLLTDSA
SADERARWKAMVKGWIVRDQYAPVWSDTAMTIAELARLKKLVDDETVAAAPEPTTGHSVFSSMDRVVHRRPGWAA
SVSMSSVRTSFYETGNGENKRGWHANSGMLYWWTADGLGQYSDRFWPTVDPYRLPGTTVSRKPLADGAGGKWGRD
MPDAEWVGGATDGEFGAIGQDVRGLESSLRGHKSWFFLADVIVCLGAGLSSTDGEVVETTYDNRNLGASGTDMIL
TVDGLRQPSSTVGNSLELVGASWAHLQHSGGYLFLDDGAVIALREARTGSRRDIDDEGSPTTFTRTYLGLYRHHG
IDPTNSSYAYAVLPGATANQTRAAVGSVQVVENGADIQAVRIGDVFAANFFAPGVVGALRVSAPCSVLIRASTVY
IADPTRSINNTIQVEWQNKTRSVSLDGKAGATVSLDFSIPFLPSPAIPASI
Coding >Ophio5|5202
ATGAGACTCGACCTTCTCGTCACCAGCCTGTTGGCGTTGAAAAGTGTGAACAGAGCGCTGGCAAGGCCGACGACA
GACGAGCCCAACCTCGCCCTTCGGAGGCCAAGCCAACGAGATTGGTCGACGGTTGATTCTGCGGGAAATGAGAAG
CCGACGTACGCGTCTGGGGATAGCTTCGACAGATTGCGGCAGCGCTGGCGCGATATGATTCTCGGTACTGACTTT
CCCGCCCAGTCGAAGCCGTTCAAGTCTCTTCTCCTGTCTCTCGGGAGGAGAGCGGCCCGGTTCGGCGATGGCTTC
GCCCCGGCCTCCGGATGGCTCTGGCCCGATCTGGTCTACGCCGACGCCGGAGCGGAGACGACGGCGTCGCAGCAG
TCTTCGGCCATCACCAAGAGCTTTAGAAGGCTGCTCGTCATGGCACACGCCTGGGCTCAGCCCGGCACCGGCCTC
ACGGGCGACTCGGACCTACTGAGCGTCATCCTCAGGGGCGTCGACCAGTTACGGCGAGATGTCTACAATCCGTCG
CAGGAACCGTTTGGAAACTGGTGGAACTGGAAGATTGGCATCCCGGACATCTTGATGGACTTGTGCGCCATCCTC
TATCACCAACTCGGTGCTGAACGCATCGCCGACCTGGTGGCGGCCAACCAACACTTCGTTCCCGGCTCCGCCATC
GCCTCCTATCTCGGATCCAGCACGGGAGCGAACCGCATCAGCCAATGTCGCTCCGTCGTCTTTTCCGGCATCTTT
GGAAAATCGGCCTCTCGTCTGTTCCGGGCCCGCGATGCGCTCTCTCCCGTCTTCCCGCCCGTGACGTCGGGCGAC
GGCTTCTACACCGACGGTTCCTTCATACAGCACAAGTCGATTCCTTACACGGGCACCTACGGCAGCGTCCTGATC
AACGGCGTCGCCAAGCTGACGACGCTGCTGGCGGGCTCCGAGTGGGCCGTCACCGACGACCGCTTCCAGCTCTTG
CTCGACACCGTCGAAAAGTCCTTTGCCCCCTTCATCTACAACGGCCTCGTCATGGATGGCGTCTCCGGCAGGGCC
GTCAGTCGGCTGTCGACCGATCATACTCGCGGTCACAGCATCCTCGAGAGCATCTTGCTGCTGACGGACAGCGCC
TCGGCCGACGAGAGAGCTCGGTGGAAGGCCATGGTCAAGGGCTGGATCGTTCGGGACCAGTACGCTCCCGTGTGG
TCCGACACGGCCATGACCATCGCCGAACTGGCCCGGCTCAAGAAGCTAGTCGACGATGAGACGGTAGCGGCCGCT
CCGGAGCCGACGACCGGCCACTCCGTATTCTCCAGCATGGACCGTGTCGTCCATCGCCGGCCGGGCTGGGCCGCC
AGCGTCAGCATGTCCTCGGTCCGCACCAGCTTCTACGAGACCGGCAACGGCGAGAACAAGCGCGGCTGGCACGCC
AACAGCGGCATGCTCTACTGGTGGACGGCCGACGGCCTCGGTCAGTATTCCGACCGCTTCTGGCCCACCGTCGAC
CCTTATCGTCTTCCCGGTACCACCGTCTCCCGGAAGCCGCTGGCCGACGGCGCCGGCGGCAAGTGGGGCCGGGAC
ATGCCGGATGCCGAGTGGGTCGGCGGCGCCACCGACGGCGAGTTCGGGGCCATCGGTCAAGACGTTCGCGGTCTG
GAGAGCAGCCTTCGGGGCCACAAGTCGTGGTTCTTTCTCGCCGACGTCATCGTCTGCCTGGGCGCCGGCCTGTCC
AGCACCGATGGAGAAGTGGTCGAGACGACGTACGACAACCGCAACCTCGGCGCTTCCGGCACCGACATGATACTC
ACCGTAGACGGCCTTCGGCAGCCGTCGTCGACGGTAGGGAACTCACTGGAGTTGGTAGGCGCAAGCTGGGCTCAC
CTCCAACACTCCGGCGGTTACCTCTTCCTCGATGACGGTGCCGTCATCGCTCTCCGCGAGGCTCGAACCGGCAGC
CGGCGAGACATCGATGACGAAGGCAGCCCCACCACCTTCACCCGTACCTACCTCGGCCTCTACCGCCATCACGGC
ATCGACCCGACCAACAGCAGCTACGCCTACGCCGTCCTTCCGGGCGCCACCGCCAACCAGACCCGAGCCGCCGTA
GGCTCCGTCCAGGTAGTCGAGAATGGCGCCGACATACAAGCCGTTCGCATCGGTGACGTCTTTGCCGCAAACTTC
TTCGCCCCCGGCGTCGTCGGAGCGCTCCGTGTCTCGGCCCCTTGCAGCGTTCTGATCCGGGCGTCGACCGTCTAC
ATCGCCGACCCGACCAGGTCCATCAATAATACCATCCAGGTCGAGTGGCAAAACAAGACTCGCTCCGTGAGCCTT
GACGGCAAGGCGGGCGCCACTGTTTCCTTGGACTTTTCTATCCCCTTCCTTCCATCACCAGCCATTCCAGCCAGT
ATA
Transcript >Ophio5|5202
ATGAGACTCGACCTTCTCGTCACCAGCCTGTTGGCGTTGAAAAGTGTGAACAGAGCGCTGGCAAGGCCGACGACA
GACGAGCCCAACCTCGCCCTTCGGAGGCCAAGCCAACGAGATTGGTCGACGGTTGATTCTGCGGGAAATGAGAAG
CCGACGTACGCGTCTGGGGATAGCTTCGACAGATTGCGGCAGCGCTGGCGCGATATGATTCTCGGTACTGACTTT
CCCGCCCAGTCGAAGCCGTTCAAGTCTCTTCTCCTGTCTCTCGGGAGGAGAGCGGCCCGGTTCGGCGATGGCTTC
GCCCCGGCCTCCGGATGGCTCTGGCCCGATCTGGTCTACGCCGACGCCGGAGCGGAGACGACGGCGTCGCAGCAG
TCTTCGGCCATCACCAAGAGCTTTAGAAGGCTGCTCGTCATGGCACACGCCTGGGCTCAGCCCGGCACCGGCCTC
ACGGGCGACTCGGACCTACTGAGCGTCATCCTCAGGGGCGTCGACCAGTTACGGCGAGATGTCTACAATCCGTCG
CAGGAACCGTTTGGAAACTGGTGGAACTGGAAGATTGGCATCCCGGACATCTTGATGGACTTGTGCGCCATCCTC
TATCACCAACTCGGTGCTGAACGCATCGCCGACCTGGTGGCGGCCAACCAACACTTCGTTCCCGGCTCCGCCATC
GCCTCCTATCTCGGATCCAGCACGGGAGCGAACCGCATCAGCCAATGTCGCTCCGTCGTCTTTTCCGGCATCTTT
GGAAAATCGGCCTCTCGTCTGTTCCGGGCCCGCGATGCGCTCTCTCCCGTCTTCCCGCCCGTGACGTCGGGCGAC
GGCTTCTACACCGACGGTTCCTTCATACAGCACAAGTCGATTCCTTACACGGGCACCTACGGCAGCGTCCTGATC
AACGGCGTCGCCAAGCTGACGACGCTGCTGGCGGGCTCCGAGTGGGCCGTCACCGACGACCGCTTCCAGCTCTTG
CTCGACACCGTCGAAAAGTCCTTTGCCCCCTTCATCTACAACGGCCTCGTCATGGATGGCGTCTCCGGCAGGGCC
GTCAGTCGGCTGTCGACCGATCATACTCGCGGTCACAGCATCCTCGAGAGCATCTTGCTGCTGACGGACAGCGCC
TCGGCCGACGAGAGAGCTCGGTGGAAGGCCATGGTCAAGGGCTGGATCGTTCGGGACCAGTACGCTCCCGTGTGG
TCCGACACGGCCATGACCATCGCCGAACTGGCCCGGCTCAAGAAGCTAGTCGACGATGAGACGGTAGCGGCCGCT
CCGGAGCCGACGACCGGCCACTCCGTATTCTCCAGCATGGACCGTGTCGTCCATCGCCGGCCGGGCTGGGCCGCC
AGCGTCAGCATGTCCTCGGTCCGCACCAGCTTCTACGAGACCGGCAACGGCGAGAACAAGCGCGGCTGGCACGCC
AACAGCGGCATGCTCTACTGGTGGACGGCCGACGGCCTCGGTCAGTATTCCGACCGCTTCTGGCCCACCGTCGAC
CCTTATCGTCTTCCCGGTACCACCGTCTCCCGGAAGCCGCTGGCCGACGGCGCCGGCGGCAAGTGGGGCCGGGAC
ATGCCGGATGCCGAGTGGGTCGGCGGCGCCACCGACGGCGAGTTCGGGGCCATCGGTCAAGACGTTCGCGGTCTG
GAGAGCAGCCTTCGGGGCCACAAGTCGTGGTTCTTTCTCGCCGACGTCATCGTCTGCCTGGGCGCCGGCCTGTCC
AGCACCGATGGAGAAGTGGTCGAGACGACGTACGACAACCGCAACCTCGGCGCTTCCGGCACCGACATGATACTC
ACCGTAGACGGCCTTCGGCAGCCGTCGTCGACGGTAGGGAACTCACTGGAGTTGGTAGGCGCAAGCTGGGCTCAC
CTCCAACACTCCGGCGGTTACCTCTTCCTCGATGACGGTGCCGTCATCGCTCTCCGCGAGGCTCGAACCGGCAGC
CGGCGAGACATCGATGACGAAGGCAGCCCCACCACCTTCACCCGTACCTACCTCGGCCTCTACCGCCATCACGGC
ATCGACCCGACCAACAGCAGCTACGCCTACGCCGTCCTTCCGGGCGCCACCGCCAACCAGACCCGAGCCGCCGTA
GGCTCCGTCCAGGTAGTCGAGAATGGCGCCGACATACAAGCCGTTCGCATCGGTGACGTCTTTGCCGCAAACTTC
TTCGCCCCCGGCGTCGTCGGAGCGCTCCGTGTCTCGGCCCCTTGCAGCGTTCTGATCCGGGCGTCGACCGTCTAC
ATCGCCGACCCGACCAGGTCCATCAATAATACCATCCAGGTCGAGTGGCAAAACAAGACTCGCTCCGTGAGCCTT
GACGGCAAGGCGGGCGCCACTGTTTCCTTGGACTTTTCTATCCCCTTCCTTCCATCACCAGCCATTCCAGCCAGT
ATATGA
Gene >Ophio5|5202
ATGAGACTCGACCTTCTCGTCACCAGCCTGTTGGCGTTGAAAAGTGTGAACAGAGCGCTGGCAAGGCCGACGACA
GACGAGCCCAACCTCGCCCTTCGGAGGCCAAGCCAACGAGATTGGTCGACGGTTGATTCTGCGGGAAATGAGAAG
CCGACGTACGCGTCTGGGGATAGCTTCGACAGATTGCGGCAGCGCTGGCGCGATATGATTCTCGGTACTGACTTT
CCCGCCCAGTCGAAGCCGTTCAAGTCTCTTCTCCTGTCTCTCGGGAGGAGAGCGGCCCGGTTCGGCGATGGCTTC
GCCCCGGCCTCCGGATGGCTCTGGCCCGATCTGGTCTACGCCGACGCCGGAGCGGAGACGACGGCGTCGCAGCAG
TCTTCGGCCATCACCAAGAGCTTTAGAAGGCTGCTCGTCATGGCACACGCCTGGGCTCAGCCCGGCACCGGCCTC
ACGGGCGACTCGGACCTACTGAGCGTCATCCTCAGGGGCGTCGACCAGTTACGGCGAGATGTCTACAATCCGTCG
CAGGAACCGTTTGGAAACTGGTGGAACTGGAAGATTGGCATCCCGGACATCTTGATGGACTTGTGCGCCATCCTC
TATCACCAACTCGGTGCTGAACGCATCGCCGACCTGGTGGCGGCCAACCAACACTTCGTTCCCGGCTCCGCCATC
GCCTCCTATCTCGGATCCAGCACGGGAGCGAACCGCATCAGCCAATGTCGCTCCGTCGTCTTTTCCGGCATCTTT
GGAAAATCGGCCTCTCGTCTGTTCCGGGCCCGCGATGCGCTCTCTCCCGTCTTCCCGCCCGTGACGTCGGGCGAC
GGCTTCTACACCGACGGTTCCTTCATACAGCACAAGTCGATTCCTTACACGGGCACCTACGGCAGCGTCCTGATC
AACGGCGTCGCCAAGCTGACGACGCTGCTGGCGGGCTCCGAGTGGGCCGTCACCGACGACCGCTTCCAGCTCTTG
CTCGACACCGTCGAAAAGTCCTTTGCCCCCTTCATCTACAACGGCCTCGTCATGGATGGCGTCTCCGGCAGGGCC
GTCAGTCGGCTGTCGACCGATCATACTCGCGGTCACAGCATCCTCGAGAGCATCTTGCTGCTGACGGACAGCGCC
TCGGCCGACGAGAGAGCTCGGTGGAAGGCCATGGTCAAGGGCTGGATCGTTCGGGACCAGTACGCTCCCGTGTGG
TCCGACACGGCCATGACCATCGCCGAACTGGCCCGGCTCAAGAAGCTAGTCGACGATGAGACGGTAGCGGCCGCT
CCGGAGCCGACGACCGGCCACTCCGTATTCTCCAGCATGGACCGTGTCGTCCATCGCCGGCCGGGCTGGGCCGCC
AGCGTCAGCATGTCCTCGGTCCGCACCAGCTTCTACGAGACCGGCAACGGCGAGAACAAGCGCGGCTGGCACGCC
AACAGCGGCATGCTCTACTGGTGGACGGCCGACGGCCTCGGTCAGTATTCCGACCGCTTCTGGCCCACCGTCGAC
CCTTATCGTCTTCCCGGTACCACCGTCTCCCGGAAGCCGCTGGCCGACGGCGCCGGCGGCAAGTGGGGCCGGGAC
ATGCCGGATGCCGAGTGGGTCGGCGGCGCCACCGACGGCGAGTTCGGGGCCATCGGTCAAGACGTTCGCGGTCTG
GAGAGCAGCCTTCGGGGCCACAAGTCGTGGTTCTTTCTCGCCGACGTCATCGTCTGCCTGGGCGCCGGCCTGTCC
AGCACCGATGGAGAAGTGGTCGAGACGACGTACGACAACCGCAACCTCGGCGCTTCCGGCACCGACATGATACTC
ACCGTAGACGGCCTTCGGCAGCCGTCGTCGACGGTAGGGAACTCACTGGAGTTGGTAGGCGCAAGCTGGGCTCAC
CTCCAACACTCCGGCGGTTACCTCTTCCTCGATGACGGTGCCGTCATCGCTCTCCGCGAGGCTCGAACCGGCAGC
CGGCGAGACATCGATGACGAAGGCAGCCCCACCACCTTCACCCGTACCTACCTCGGCCTCTACCGCCATCACGGC
ATCGACCCGACCAACAGCAGCTACGCCTACGCCGTCCTTCCGGGCGCCACCGCCAACCAGACCCGAGCCGCCGTA
GGCTCCGTCCAGGTAGTCGAGAATGGCGCCGACATACAAGCCGTTCGCATCGGTGACGTCTTTGCCGCAAACTTC
TTCGCCCCCGGCGTCGTCGGAGCGCTCCGTGTCTCGGCCCCTTGCAGCGTTCTGATCCGGGCGTCGACCGTCTAC
ATCGCCGACCCGACCAGGTCCATCAATAATACCATCCAGGTCGAGTGGCAAAACAAGACTCGCTCCGTGAGCCTT
GACGGCAAGGCGGGCGCCACTGTTTCCTTGGACTTTTCTATCCCCTTCCTTCCATCACCAGCCATTCCAGCCAGT
ATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail