Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5201
Gene name
Locationscaffold_42:23990..26456
Strand+
Gene length (bp)2466
Transcript length (bp)2466
Coding sequence length (bp)2463
Protein length (aa) 821

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12678 zf-rbx1 RING-H2 zinc finger domain 2.1E-09 756 815
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 4.9E-06 757 814

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P36096|TUL1_YEAST Transmembrane E3 ubiquitin-protein ligase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUL1 PE=1 SV=1 246 821 6.0E-51
sp|O43085|DSC1_SCHPO DSC E3 ubiquitin ligase complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dsc1 PE=1 SV=2 343 821 2.0E-44

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0046914 transition metal ion binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 414 433 19
2 450 472 22
3 482 504 22
4 586 608 22
5 613 632 19
6 645 664 19
7 677 695 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5201
MAFSQHPVAGLILFILLLWMLFPESEYQSLAQSEIAASRVARYREALDILNTSTWGDFSPDELHVADDATEDVPD
IALNATSHFLNLTGFRQVDGFAWEDLTSFREKALRLSRHAIPPVAGRQLWDAAQGEAVWTNASGTLRGEWVRRRG
SVSRRYDSYNLSHSVPAMDWVGDRVEWARNMTGAAGRMTLRLEANRTVTRYGDMAPGTVPLSGGIIRDVKGAVTV
EDMAGSGHNWDMRLWGVHWPRQGVILMTTTSEKFEGIFGLPHLAPSPDFFLSSQMLLNGTLNSVIGWKQRNINID
PNMPWNSDVENPLYTAYPSPHCEFVMYAQVYPPIERASPALDETDRSEDVLRAIEAELQNPEGAPIGSVPRLKMS
AVIYSPDCAFFLETKGPPDFPPTERSHLVGVKTEVHIRQVQMWIITYALVISAQVFLFKNQMKELFTPSTMGRIS
FWTISAMGVVDGMTFIAALTWVSSAGATFLPTLALAFAAFLSSLTAGCLLSKIYEVQLPEGRSRREAGSGEGGAT
ATPPADAGMVPLLPGLATEAHLLGFAPLPLIVPSDQDVDAEMAAPQAVGSPVPQPLTFNSVLGRLVLFTVCMIFM
SVSSSTWHPRARSLFLSLCAFVYLSLWVPQIYRNTMRNCRRAMRWPFVVGQTVLRLLPVAYFWVKEDNFLYARPD
RMAFAVLVAWVWLQLVVLAVQEVMGPRFGIPAGWTPDGWDYHPVLGEDAVEAGGLPIGLVSDDSRRGSNASVKRG
NMRAIDCAICHEALEVPVLRAGDEDGSVANVFARRLYMMTPCRHIFHTYCLEGWMRFRLQCPICREDLPPI
Coding >Ophio5|5201
ATGGCCTTCAGTCAGCATCCCGTCGCTGGCCTCATCCTCTTTATTCTCCTCCTATGGATGCTTTTTCCCGAGAGC
GAATATCAGTCGCTCGCGCAGTCTGAGATCGCCGCCAGCCGCGTTGCGCGCTACCGTGAAGCCCTCGACATCCTC
AACACCTCGACCTGGGGCGACTTTTCGCCCGATGAGCTTCATGTCGCCGATGATGCCACCGAGGACGTACCCGAT
ATCGCGCTCAACGCCACATCGCACTTCCTCAACCTCACCGGCTTCCGCCAAGTCGACGGCTTCGCCTGGGAGGAT
CTCACCAGCTTCCGTGAAAAGGCCTTGCGCCTCAGCCGCCATGCCATCCCCCCCGTGGCCGGTCGCCAGCTATGG
GACGCGGCACAGGGCGAGGCCGTCTGGACCAACGCGTCCGGCACCCTCCGCGGCGAGTGGGTTCGCCGCCGCGGC
TCCGTCTCCCGCCGCTACGACAGCTACAACTTGAGCCACAGCGTGCCGGCCATGGACTGGGTCGGCGACCGCGTC
GAATGGGCGCGTAACATGACGGGTGCCGCCGGCCGCATGACGCTCCGTCTCGAAGCTAACCGCACCGTGACCAGA
TATGGCGATATGGCTCCCGGGACCGTGCCTCTCTCCGGCGGCATCATCCGCGATGTCAAGGGCGCCGTTACCGTC
GAGGACATGGCCGGCTCCGGTCACAACTGGGATATGCGTCTCTGGGGAGTCCACTGGCCGCGTCAGGGCGTTATC
CTGATGACTACGACAAGCGAAAAGTTTGAGGGCATCTTTGGCCTGCCACACCTGGCCCCGAGCCCTGACTTCTTC
TTGTCGAGCCAGATGCTGCTAAACGGCACGCTCAACAGCGTCATCGGCTGGAAACAGCGCAATATTAATATCGAT
CCGAACATGCCCTGGAACTCGGATGTAGAGAATCCGCTCTACACGGCCTACCCCTCGCCACACTGTGAGTTCGTC
ATGTACGCCCAGGTCTACCCGCCGATAGAGCGCGCCTCGCCAGCACTGGACGAGACGGACCGGTCCGAGGACGTC
CTCCGCGCCATCGAGGCGGAGCTTCAGAACCCCGAGGGCGCTCCCATCGGTTCCGTCCCGCGCCTCAAAATGTCG
GCCGTCATCTACTCGCCTGATTGCGCATTCTTCCTCGAAACCAAGGGCCCTCCCGACTTTCCGCCGACGGAGAGG
AGCCATCTGGTTGGTGTGAAGACCGAGGTTCACATTCGCCAGGTTCAGATGTGGATAATCACCTACGCCCTCGTC
ATCTCCGCCCAGGTGTTCCTGTTTAAGAACCAGATGAAGGAGTTGTTTACGCCCTCTACCATGGGTCGTATCAGT
TTCTGGACCATCAGCGCCATGGGAGTCGTCGACGGGATGACTTTTATCGCTGCTCTCACCTGGGTGTCTTCGGCG
GGCGCCACCTTCTTGCCGACGTTGGCTCTCGCGTTCGCTGCCTTTTTGTCGTCGTTGACGGCCGGCTGCCTACTC
TCAAAGATTTACGAAGTCCAATTGCCCGAGGGCCGCTCTCGGCGAGAGGCCGGTTCGGGCGAAGGAGGCGCGACG
GCAACACCGCCGGCGGACGCGGGCATGGTGCCTCTGCTGCCTGGACTGGCGACCGAGGCACATCTCTTAGGGTTC
GCGCCCTTGCCTCTGATCGTTCCCTCGGATCAAGACGTCGACGCCGAGATGGCCGCTCCCCAGGCCGTCGGCAGC
CCCGTGCCGCAGCCGCTGACGTTCAACAGTGTCTTGGGCCGCTTAGTCCTCTTCACTGTCTGCATGATCTTCATG
TCTGTCTCGTCGTCGACGTGGCATCCCCGTGCGCGGTCTCTATTTCTCAGCCTATGTGCATTCGTCTACCTGTCG
CTCTGGGTGCCACAGATCTACCGCAATACGATGCGCAACTGCCGCCGCGCCATGAGGTGGCCGTTCGTCGTCGGG
CAGACGGTGCTCCGCCTCCTGCCTGTTGCCTACTTCTGGGTCAAGGAGGATAATTTCCTGTACGCTAGGCCCGAC
CGTATGGCCTTTGCCGTGCTCGTTGCCTGGGTCTGGCTGCAGCTAGTGGTGCTTGCGGTACAGGAGGTCATGGGT
CCTCGCTTCGGCATACCGGCCGGCTGGACGCCCGACGGCTGGGACTACCACCCTGTGCTGGGCGAGGACGCGGTC
GAGGCGGGCGGCCTGCCCATCGGGCTCGTGTCCGACGATTCGCGTCGCGGGAGTAATGCGTCCGTCAAACGCGGA
AACATGCGCGCCATCGACTGCGCCATCTGTCACGAGGCTCTCGAGGTGCCTGTCCTCAGGGCCGGCGACGAGGAC
GGCAGCGTGGCCAACGTGTTTGCGAGGAGGCTTTACATGATGACGCCGTGTCGGCACATCTTTCACACGTATTGC
CTCGAGGGCTGGATGCGCTTCAGGCTGCAGTGTCCGATTTGCAGAGAGGACCTGCCGCCTATA
Transcript >Ophio5|5201
ATGGCCTTCAGTCAGCATCCCGTCGCTGGCCTCATCCTCTTTATTCTCCTCCTATGGATGCTTTTTCCCGAGAGC
GAATATCAGTCGCTCGCGCAGTCTGAGATCGCCGCCAGCCGCGTTGCGCGCTACCGTGAAGCCCTCGACATCCTC
AACACCTCGACCTGGGGCGACTTTTCGCCCGATGAGCTTCATGTCGCCGATGATGCCACCGAGGACGTACCCGAT
ATCGCGCTCAACGCCACATCGCACTTCCTCAACCTCACCGGCTTCCGCCAAGTCGACGGCTTCGCCTGGGAGGAT
CTCACCAGCTTCCGTGAAAAGGCCTTGCGCCTCAGCCGCCATGCCATCCCCCCCGTGGCCGGTCGCCAGCTATGG
GACGCGGCACAGGGCGAGGCCGTCTGGACCAACGCGTCCGGCACCCTCCGCGGCGAGTGGGTTCGCCGCCGCGGC
TCCGTCTCCCGCCGCTACGACAGCTACAACTTGAGCCACAGCGTGCCGGCCATGGACTGGGTCGGCGACCGCGTC
GAATGGGCGCGTAACATGACGGGTGCCGCCGGCCGCATGACGCTCCGTCTCGAAGCTAACCGCACCGTGACCAGA
TATGGCGATATGGCTCCCGGGACCGTGCCTCTCTCCGGCGGCATCATCCGCGATGTCAAGGGCGCCGTTACCGTC
GAGGACATGGCCGGCTCCGGTCACAACTGGGATATGCGTCTCTGGGGAGTCCACTGGCCGCGTCAGGGCGTTATC
CTGATGACTACGACAAGCGAAAAGTTTGAGGGCATCTTTGGCCTGCCACACCTGGCCCCGAGCCCTGACTTCTTC
TTGTCGAGCCAGATGCTGCTAAACGGCACGCTCAACAGCGTCATCGGCTGGAAACAGCGCAATATTAATATCGAT
CCGAACATGCCCTGGAACTCGGATGTAGAGAATCCGCTCTACACGGCCTACCCCTCGCCACACTGTGAGTTCGTC
ATGTACGCCCAGGTCTACCCGCCGATAGAGCGCGCCTCGCCAGCACTGGACGAGACGGACCGGTCCGAGGACGTC
CTCCGCGCCATCGAGGCGGAGCTTCAGAACCCCGAGGGCGCTCCCATCGGTTCCGTCCCGCGCCTCAAAATGTCG
GCCGTCATCTACTCGCCTGATTGCGCATTCTTCCTCGAAACCAAGGGCCCTCCCGACTTTCCGCCGACGGAGAGG
AGCCATCTGGTTGGTGTGAAGACCGAGGTTCACATTCGCCAGGTTCAGATGTGGATAATCACCTACGCCCTCGTC
ATCTCCGCCCAGGTGTTCCTGTTTAAGAACCAGATGAAGGAGTTGTTTACGCCCTCTACCATGGGTCGTATCAGT
TTCTGGACCATCAGCGCCATGGGAGTCGTCGACGGGATGACTTTTATCGCTGCTCTCACCTGGGTGTCTTCGGCG
GGCGCCACCTTCTTGCCGACGTTGGCTCTCGCGTTCGCTGCCTTTTTGTCGTCGTTGACGGCCGGCTGCCTACTC
TCAAAGATTTACGAAGTCCAATTGCCCGAGGGCCGCTCTCGGCGAGAGGCCGGTTCGGGCGAAGGAGGCGCGACG
GCAACACCGCCGGCGGACGCGGGCATGGTGCCTCTGCTGCCTGGACTGGCGACCGAGGCACATCTCTTAGGGTTC
GCGCCCTTGCCTCTGATCGTTCCCTCGGATCAAGACGTCGACGCCGAGATGGCCGCTCCCCAGGCCGTCGGCAGC
CCCGTGCCGCAGCCGCTGACGTTCAACAGTGTCTTGGGCCGCTTAGTCCTCTTCACTGTCTGCATGATCTTCATG
TCTGTCTCGTCGTCGACGTGGCATCCCCGTGCGCGGTCTCTATTTCTCAGCCTATGTGCATTCGTCTACCTGTCG
CTCTGGGTGCCACAGATCTACCGCAATACGATGCGCAACTGCCGCCGCGCCATGAGGTGGCCGTTCGTCGTCGGG
CAGACGGTGCTCCGCCTCCTGCCTGTTGCCTACTTCTGGGTCAAGGAGGATAATTTCCTGTACGCTAGGCCCGAC
CGTATGGCCTTTGCCGTGCTCGTTGCCTGGGTCTGGCTGCAGCTAGTGGTGCTTGCGGTACAGGAGGTCATGGGT
CCTCGCTTCGGCATACCGGCCGGCTGGACGCCCGACGGCTGGGACTACCACCCTGTGCTGGGCGAGGACGCGGTC
GAGGCGGGCGGCCTGCCCATCGGGCTCGTGTCCGACGATTCGCGTCGCGGGAGTAATGCGTCCGTCAAACGCGGA
AACATGCGCGCCATCGACTGCGCCATCTGTCACGAGGCTCTCGAGGTGCCTGTCCTCAGGGCCGGCGACGAGGAC
GGCAGCGTGGCCAACGTGTTTGCGAGGAGGCTTTACATGATGACGCCGTGTCGGCACATCTTTCACACGTATTGC
CTCGAGGGCTGGATGCGCTTCAGGCTGCAGTGTCCGATTTGCAGAGAGGACCTGCCGCCTATATGA
Gene >Ophio5|5201
ATGGCCTTCAGTCAGCATCCCGTCGCTGGCCTCATCCTCTTTATTCTCCTCCTATGGATGCTTTTTCCCGAGAGC
GAATATCAGTCGCTCGCGCAGTCTGAGATCGCCGCCAGCCGCGTTGCGCGCTACCGTGAAGCCCTCGACATCCTC
AACACCTCGACCTGGGGCGACTTTTCGCCCGATGAGCTTCATGTCGCCGATGATGCCACCGAGGACGTACCCGAT
ATCGCGCTCAACGCCACATCGCACTTCCTCAACCTCACCGGCTTCCGCCAAGTCGACGGCTTCGCCTGGGAGGAT
CTCACCAGCTTCCGTGAAAAGGCCTTGCGCCTCAGCCGCCATGCCATCCCCCCCGTGGCCGGTCGCCAGCTATGG
GACGCGGCACAGGGCGAGGCCGTCTGGACCAACGCGTCCGGCACCCTCCGCGGCGAGTGGGTTCGCCGCCGCGGC
TCCGTCTCCCGCCGCTACGACAGCTACAACTTGAGCCACAGCGTGCCGGCCATGGACTGGGTCGGCGACCGCGTC
GAATGGGCGCGTAACATGACGGGTGCCGCCGGCCGCATGACGCTCCGTCTCGAAGCTAACCGCACCGTGACCAGA
TATGGCGATATGGCTCCCGGGACCGTGCCTCTCTCCGGCGGCATCATCCGCGATGTCAAGGGCGCCGTTACCGTC
GAGGACATGGCCGGCTCCGGTCACAACTGGGATATGCGTCTCTGGGGAGTCCACTGGCCGCGTCAGGGCGTTATC
CTGATGACTACGACAAGCGAAAAGTTTGAGGGCATCTTTGGCCTGCCACACCTGGCCCCGAGCCCTGACTTCTTC
TTGTCGAGCCAGATGCTGCTAAACGGCACGCTCAACAGCGTCATCGGCTGGAAACAGCGCAATATTAATATCGAT
CCGAACATGCCCTGGAACTCGGATGTAGAGAATCCGCTCTACACGGCCTACCCCTCGCCACACTGTGAGTTCGTC
ATGTACGCCCAGGTCTACCCGCCGATAGAGCGCGCCTCGCCAGCACTGGACGAGACGGACCGGTCCGAGGACGTC
CTCCGCGCCATCGAGGCGGAGCTTCAGAACCCCGAGGGCGCTCCCATCGGTTCCGTCCCGCGCCTCAAAATGTCG
GCCGTCATCTACTCGCCTGATTGCGCATTCTTCCTCGAAACCAAGGGCCCTCCCGACTTTCCGCCGACGGAGAGG
AGCCATCTGGTTGGTGTGAAGACCGAGGTTCACATTCGCCAGGTTCAGATGTGGATAATCACCTACGCCCTCGTC
ATCTCCGCCCAGGTGTTCCTGTTTAAGAACCAGATGAAGGAGTTGTTTACGCCCTCTACCATGGGTCGTATCAGT
TTCTGGACCATCAGCGCCATGGGAGTCGTCGACGGGATGACTTTTATCGCTGCTCTCACCTGGGTGTCTTCGGCG
GGCGCCACCTTCTTGCCGACGTTGGCTCTCGCGTTCGCTGCCTTTTTGTCGTCGTTGACGGCCGGCTGCCTACTC
TCAAAGATTTACGAAGTCCAATTGCCCGAGGGCCGCTCTCGGCGAGAGGCCGGTTCGGGCGAAGGAGGCGCGACG
GCAACACCGCCGGCGGACGCGGGCATGGTGCCTCTGCTGCCTGGACTGGCGACCGAGGCACATCTCTTAGGGTTC
GCGCCCTTGCCTCTGATCGTTCCCTCGGATCAAGACGTCGACGCCGAGATGGCCGCTCCCCAGGCCGTCGGCAGC
CCCGTGCCGCAGCCGCTGACGTTCAACAGTGTCTTGGGCCGCTTAGTCCTCTTCACTGTCTGCATGATCTTCATG
TCTGTCTCGTCGTCGACGTGGCATCCCCGTGCGCGGTCTCTATTTCTCAGCCTATGTGCATTCGTCTACCTGTCG
CTCTGGGTGCCACAGATCTACCGCAATACGATGCGCAACTGCCGCCGCGCCATGAGGTGGCCGTTCGTCGTCGGG
CAGACGGTGCTCCGCCTCCTGCCTGTTGCCTACTTCTGGGTCAAGGAGGATAATTTCCTGTACGCTAGGCCCGAC
CGTATGGCCTTTGCCGTGCTCGTTGCCTGGGTCTGGCTGCAGCTAGTGGTGCTTGCGGTACAGGAGGTCATGGGT
CCTCGCTTCGGCATACCGGCCGGCTGGACGCCCGACGGCTGGGACTACCACCCTGTGCTGGGCGAGGACGCGGTC
GAGGCGGGCGGCCTGCCCATCGGGCTCGTGTCCGACGATTCGCGTCGCGGGAGTAATGCGTCCGTCAAACGCGGA
AACATGCGCGCCATCGACTGCGCCATCTGTCACGAGGCTCTCGAGGTGCCTGTCCTCAGGGCCGGCGACGAGGAC
GGCAGCGTGGCCAACGTGTTTGCGAGGAGGCTTTACATGATGACGCCGTGTCGGCACATCTTTCACACGTATTGC
CTCGAGGGCTGGATGCGCTTCAGGCTGCAGTGTCCGATTTGCAGAGAGGACCTGCCGCCTATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail