Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|52
Gene name
Locationscaffold_1:123775..125730
Strand-
Gene length (bp)1955
Transcript length (bp)1656
Coding sequence length (bp)1653
Protein length (aa) 551

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.9E-30 23 307
PF00083 Sugar_tr Sugar (and other) transporter 3.5E-08 54 198

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 11 494 3.0E-58
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 2 484 1.0E-40
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 1 461 1.0E-40
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 1 483 6.0E-38
sp|P33733|TCR4_SALOR Tetracycline resistance protein, class D OS=Salmonella ordonez GN=tetA PE=3 SV=1 17 173 3.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 11 494 3.0E-58
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 2 484 1.0E-40
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 1 461 1.0E-40
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 1 483 6.0E-38
sp|P33733|TCR4_SALOR Tetracycline resistance protein, class D OS=Salmonella ordonez GN=tetA PE=3 SV=1 17 173 3.0E-10
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 18 173 7.0E-10
sp|P51564|TCR8_PASMD Tetracycline resistance protein, class H OS=Pasteurella multocida GN=tetA PE=3 SV=1 33 173 8.0E-10
sp|Q5HHX4|NORA_STAAC Quinolone resistance protein NorA OS=Staphylococcus aureus (strain COL) GN=norA PE=3 SV=1 33 176 1.0E-08
sp|P0A0J6|NORA_STAAW Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MW2) GN=norA PE=3 SV=1 33 176 1.0E-08
sp|P0A0J7|NORA_STAAU Quinolone resistance protein NorA OS=Staphylococcus aureus GN=norA PE=3 SV=1 33 176 1.0E-08
sp|P0A0J5|NORA_STAAN Quinolone resistance protein NorA OS=Staphylococcus aureus (strain N315) GN=norA PE=3 SV=1 33 176 1.0E-08
sp|P0A0J4|NORA_STAAM Quinolone resistance protein NorA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=norA PE=3 SV=1 33 176 1.0E-08
sp|Q6GBD5|NORA_STAAS Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MSSA476) GN=norA PE=3 SV=1 33 176 1.0E-08
sp|Q6GIU7|NORA_STAAR Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MRSA252) GN=norA PE=3 SV=1 33 176 2.0E-08
sp|Q0P5M9|MFS10_BOVIN Major facilitator superfamily domain-containing protein 10 OS=Bos taurus GN=MFSD10 PE=2 SV=1 56 244 1.0E-07
sp|P0A4K5|PMRA_STRR6 Multi-drug resistance efflux pump PmrA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pmrA PE=3 SV=1 33 167 4.0E-07
sp|P0A4K4|PMRA_STRPN Multi-drug resistance efflux pump PmrA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pmrA PE=3 SV=1 33 167 4.0E-07
sp|Q95R48|OCTL_DROME Organic cation transporter-like protein OS=Drosophila melanogaster GN=Orct2 PE=2 SV=2 60 292 4.0E-07
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 12 165 5.0E-07
sp|B4EYY4|MDTG_PROMH Multidrug resistance protein MdtG OS=Proteus mirabilis (strain HI4320) GN=mdtG PE=3 SV=1 30 176 1.0E-06
sp|P02981|TCR3_ECOLX Tetracycline resistance protein, class C OS=Escherichia coli GN=tetA PE=1 SV=1 33 173 1.0E-06
sp|Q14728|MFS10_HUMAN Major facilitator superfamily domain-containing protein 10 OS=Homo sapiens GN=MFSD10 PE=1 SV=1 56 224 3.0E-06
sp|Q9D2V8|MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus GN=Mfsd10 PE=1 SV=1 56 166 3.0E-06
sp|Q07282|TCR5_ECOLX Tetracycline resistance protein, class E OS=Escherichia coli GN=tetA PE=3 SV=1 33 173 4.0E-06
sp|P36890|TCR_STAHY Tetracycline resistance protein OS=Staphylococcus hyicus GN=tet PE=3 SV=1 37 175 4.0E-06
sp|P0A4K6|TCR_STREE Tetracycline resistance protein OS=Streptococcus pneumoniae GN=tet PE=3 SV=1 37 175 4.0E-06
sp|P0A4K8|TCR_BACIU Tetracycline resistance protein OS=Bacillus subtilis GN=tet PE=3 SV=1 37 175 4.0E-06
sp|P0A4K7|TCR_BACCE Tetracycline resistance protein OS=Bacillus cereus GN=tet PE=3 SV=1 37 175 4.0E-06
sp|P07561|TCR_GEOSE Tetracycline resistance protein OS=Geobacillus stearothermophilus GN=tet PE=3 SV=1 37 175 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 51 73 22
2 85 107 22
3 144 166 22
4 187 209 22
5 335 354 19
6 361 383 22
7 398 420 22
8 463 485 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|52
MTESAQLGPKLPVQQLVILVVARLAEPLAYTSIYPYLPEMIGDFGIPQVDIARWAGLITAVFAVSQGLAAVPWGR
ASDRYGRKPIVLCGLASTMICFLIWGMSTSLTMAIVARAIQGAGSGNVAIIRTIVAEIVPVKELQPRAFSIMPLV
WSIGSVVGPAFGGFFAQPASKYPDWFGQMEFFRRFPYALPNLIATIFFLFSATTTFLFLEESLSSKRGQPDVGLA
LGRRLTRLFSRNSKAARTPLVDAEAPSAQDASHVPSQKLLPSEPPPGMKEVFKRQTIISLVAYTITSMHSVSFDQ
NVTVFLNYPVMEHTPDNTRLPFCFNGGFGLKSGKIGIIFAIYGTTCGLIQFFLYPPLCKRFGVLKCWQFCSIAMP
FIYFITPYASLFPTQQSRLTAMVAVLMLKGLVGIIAFPCITILFTNSCTSTRILGTVNGFATAFSGFARALGPAS
TGFAFTWGAKHGCIAAAYYFLALVAALGAIPGFMVEDGDGPSAEAEPINVCRPRSESESTAGVDDLDDSVNTPLL
AAANSRGYGARESRQRSAQGPFRQPS
Coding >Ophio5|52
ATGACGGAATCAGCGCAACTGGGGCCAAAGCTGCCTGTCCAGCAGCTCGTCATCCTGGTCGTTGCGCGACTCGCC
GAGCCCCTGGCGTACACATCCATCTACCCGTATCTGCCTGAGATGATCGGCGACTTTGGAATCCCCCAGGTCGAC
ATCGCCCGCTGGGCCGGCCTCATCACCGCCGTCTTCGCCGTCAGCCAGGGTCTGGCCGCCGTTCCGTGGGGCCGT
GCGTCTGATCGGTACGGGAGAAAGCCCATCGTCCTCTGTGGCCTCGCCAGCACCATGATCTGCTTCCTCATCTGG
GGCATGTCCACCAGCTTGACCATGGCCATCGTTGCGCGCGCCATCCAGGGCGCGGGGAGCGGAAACGTCGCCATA
ATCAGGACCATTGTGGCCGAGATTGTTCCCGTAAAGGAGTTGCAGCCCCGGGCCTTTTCCATCATGCCGTTGGTA
TGGTCCATCGGCTCTGTCGTTGGGCCTGCTTTCGGAGGCTTCTTTGCCCAGCCGGCAAGTAAGTATCCCGACTGG
TTCGGCCAGATGGAATTTTTTCGGCGCTTCCCGTATGCTCTACCCAACCTCATCGCCACCATCTTCTTCCTATTT
TCCGCGACTACGACATTTCTTTTCCTCGAGGAATCTCTCTCGTCCAAGCGCGGCCAGCCAGACGTCGGCCTCGCC
CTTGGCCGACGTCTCACTCGCCTGTTCTCGCGAAATTCGAAAGCGGCCCGAACGCCACTGGTGGATGCCGAGGCG
CCCTCGGCGCAAGACGCAAGTCATGTCCCGTCGCAGAAGCTGCTGCCCTCGGAGCCGCCGCCGGGGATGAAGGAG
GTTTTCAAACGCCAGACCATCATCAGCCTCGTGGCATACACTATTACGTCGATGCACTCGGTATCGTTCGATCAG
AATGTCACCGTCTTCCTCAACTACCCCGTCATGGAGCACACTCCGGACAACACGCGGCTGCCCTTTTGCTTCAAC
GGCGGCTTCGGGCTCAAGTCGGGCAAGATTGGCATCATTTTTGCCATCTACGGCACCACCTGCGGCCTCATCCAG
TTCTTTTTATATCCGCCCCTGTGCAAGCGCTTCGGCGTCTTGAAGTGCTGGCAGTTCTGCTCAATCGCGATGCCC
TTCATCTACTTCATCACGCCCTACGCCTCCCTATTTCCCACACAACAAAGTCGTCTGACGGCCATGGTCGCCGTC
CTGATGCTGAAAGGCCTCGTCGGCATCATCGCCTTCCCCTGCATAACCATCCTCTTCACCAACTCGTGCACGTCG
ACGCGCATCCTCGGCACCGTCAACGGCTTCGCCACCGCCTTTAGCGGCTTCGCCCGCGCCCTCGGCCCGGCATCG
ACCGGCTTCGCCTTCACCTGGGGCGCCAAGCACGGCTGCATCGCAGCCGCGTATTACTTCCTCGCCCTCGTTGCT
GCCCTCGGCGCCATCCCCGGCTTCATGGTCGAGGACGGTGACGGTCCGTCTGCCGAGGCCGAGCCCATCAACGTC
TGTCGCCCTCGGTCCGAGTCCGAGTCGACCGCCGGAGTCGACGACCTTGACGACAGCGTCAACACCCCGCTGCTG
GCTGCCGCGAACTCTCGCGGCTATGGCGCGCGCGAAAGCCGTCAGAGGTCTGCTCAGGGACCCTTTCGCCAGCCC
TCT
Transcript >Ophio5|52
ATGACGGAATCAGCGCAACTGGGGCCAAAGCTGCCTGTCCAGCAGCTCGTCATCCTGGTCGTTGCGCGACTCGCC
GAGCCCCTGGCGTACACATCCATCTACCCGTATCTGCCTGAGATGATCGGCGACTTTGGAATCCCCCAGGTCGAC
ATCGCCCGCTGGGCCGGCCTCATCACCGCCGTCTTCGCCGTCAGCCAGGGTCTGGCCGCCGTTCCGTGGGGCCGT
GCGTCTGATCGGTACGGGAGAAAGCCCATCGTCCTCTGTGGCCTCGCCAGCACCATGATCTGCTTCCTCATCTGG
GGCATGTCCACCAGCTTGACCATGGCCATCGTTGCGCGCGCCATCCAGGGCGCGGGGAGCGGAAACGTCGCCATA
ATCAGGACCATTGTGGCCGAGATTGTTCCCGTAAAGGAGTTGCAGCCCCGGGCCTTTTCCATCATGCCGTTGGTA
TGGTCCATCGGCTCTGTCGTTGGGCCTGCTTTCGGAGGCTTCTTTGCCCAGCCGGCAAGTAAGTATCCCGACTGG
TTCGGCCAGATGGAATTTTTTCGGCGCTTCCCGTATGCTCTACCCAACCTCATCGCCACCATCTTCTTCCTATTT
TCCGCGACTACGACATTTCTTTTCCTCGAGGAATCTCTCTCGTCCAAGCGCGGCCAGCCAGACGTCGGCCTCGCC
CTTGGCCGACGTCTCACTCGCCTGTTCTCGCGAAATTCGAAAGCGGCCCGAACGCCACTGGTGGATGCCGAGGCG
CCCTCGGCGCAAGACGCAAGTCATGTCCCGTCGCAGAAGCTGCTGCCCTCGGAGCCGCCGCCGGGGATGAAGGAG
GTTTTCAAACGCCAGACCATCATCAGCCTCGTGGCATACACTATTACGTCGATGCACTCGGTATCGTTCGATCAG
AATGTCACCGTCTTCCTCAACTACCCCGTCATGGAGCACACTCCGGACAACACGCGGCTGCCCTTTTGCTTCAAC
GGCGGCTTCGGGCTCAAGTCGGGCAAGATTGGCATCATTTTTGCCATCTACGGCACCACCTGCGGCCTCATCCAG
TTCTTTTTATATCCGCCCCTGTGCAAGCGCTTCGGCGTCTTGAAGTGCTGGCAGTTCTGCTCAATCGCGATGCCC
TTCATCTACTTCATCACGCCCTACGCCTCCCTATTTCCCACACAACAAAGTCGTCTGACGGCCATGGTCGCCGTC
CTGATGCTGAAAGGCCTCGTCGGCATCATCGCCTTCCCCTGCATAACCATCCTCTTCACCAACTCGTGCACGTCG
ACGCGCATCCTCGGCACCGTCAACGGCTTCGCCACCGCCTTTAGCGGCTTCGCCCGCGCCCTCGGCCCGGCATCG
ACCGGCTTCGCCTTCACCTGGGGCGCCAAGCACGGCTGCATCGCAGCCGCGTATTACTTCCTCGCCCTCGTTGCT
GCCCTCGGCGCCATCCCCGGCTTCATGGTCGAGGACGGTGACGGTCCGTCTGCCGAGGCCGAGCCCATCAACGTC
TGTCGCCCTCGGTCCGAGTCCGAGTCGACCGCCGGAGTCGACGACCTTGACGACAGCGTCAACACCCCGCTGCTG
GCTGCCGCGAACTCTCGCGGCTATGGCGCGCGCGAAAGCCGTCAGAGGTCTGCTCAGGGACCCTTTCGCCAGCCC
TCTTAG
Gene >Ophio5|52
ATGACGGAATCAGCGCAACTGGGGCCAAAGCTGCCTGTCCAGCAGCTCGTCATCCTGGGTGAGGCCGCCGCTTCC
CGACGAAGTCAGGTCCAAGTTCATCTACCTCTTTTGTGCTGACTCTCTGTTCGCAGTCGTTGCGCGACTCGCCGA
GCCCCTGGCGTACACATCCATCTACCCGTATCTGCCTGAGATGATCGGCGACTTTGGAATCCCCCAGGTCGACAT
CGCCCGCTGGGCCGGCCTCATCACCGCCGTCTTCGCCGTCAGCCAGGGTCTGGCCGCCGTTCCGTGGGGCCGTGC
GTCTGATCGGTACGGGAGAAAGCCCATCGTCCTCTGTGGCCTCGCCAGCACCATGATCTGCTTCCTCATCTGGGG
CATGTCCACCAGCTTGACCATGGCCATCGTTGCGCGCGCCATCCAGGGCGCGGGGAGCGGAAACGGTACGTGAAC
CCGCCCATGACAACTCGGACTGTCGCTAACCACGGTTCGCAGTCGCCATAATCAGGACCATTGTGGCCGAGATTG
TTCCCGTAAAGGAGTTGCAGCCCCGGGCCTTTTCCATCATGCCGTTGGTATGGTCCATCGGCTCTGTCGTTGGGC
CTGCTTTCGGAGGCTTCTTTGCCCAGCCGGCAAGTAAGTATCCCGACTGGTTCGGCCAGATGGAATTTTTTCGGC
GCTTCCCGTATGCTCTACCCAACCTCATCGCCACCATCTTCTTCCTATTTTCCGCGACTACGACATTTCTTTTCC
TCGAGGTACGCGCCCCCCTGGCCCTTCCCCCCTTTTTACCCCGTGGAGCCAACGTGGTCGGGTCTGAACGTTGTC
AAGGAATCTCTCTCGTCCAAGCGCGGCCAGCCAGACGTCGGCCTCGCCCTTGGCCGACGTCTCACTCGCCTGTTC
TCGCGAAATTCGAAAGCGGCCCGAACGCCACTGGTGGATGCCGAGGCGCCCTCGGCGCAAGACGCAAGTCATGTC
CCGTCGCAGAAGCTGCTGCCCTCGGAGCCGCCGCCGGGGATGAAGGAGGTTTTCAAACGCCAGACCATCATCAGC
CTCGTGGCATACACTATTACGTCGATGCACTCGGTATCGTTCGATCAGAATGTCACCGTCTTCCTCAACTACCCC
GTCATGGAGCACACTCCGGACAACACGCGGCTGCCCTTTTGCTTCAACGGCGGCTTCGGGCTCAAGTCGGGCAAG
ATTGGCATCATTTTTGCCATCTACGGCACCACCTGCGGCCTCATCCAGTTCTTTTTATATCCGCCCCTGTGCAAG
CGCTTCGGCGTCTTGAAGTGCTGGCAGTTCTGCTGTGGGTTGTCCCCCCTTTCCCCCCCCCCCCTTTTTCTTTCC
GTCCCGCCTGTACGCCGAGGTGTCCATCTCGAATGCGGTTGACGCGAGACACCTGCGCAGCAATCGCGATGCCCT
TCATCTACTTCATCACGCCCTACGCCTCCCTATTTCCCACACAACAAAGTCGTCTGACGGCCATGGTCGCCGTCC
TGATGCTGAAAGGCCTCGTCGGCATCATCGCCTTCCCCTGCATAACCATCCTCTTCACCAACTCGTGCACGTCGA
CGCGCATCCTCGGCACCGTCAACGGCTTCGCCACCGCCTTTAGCGGCTTCGCCCGCGCCCTCGGCCCGGCATCGA
CCGGCTTCGCCTTCACCTGGGGCGCCAAGCACGGCTGCATCGCAGCCGCGTATTACTTCCTCGCCCTCGTTGCTG
CCCTCGGCGCCATCCCCGGCTTCATGGTCGAGGACGGTGACGGTCCGTCTGCCGAGGCCGAGCCCATCAACGTCT
GTCGCCCTCGGTCCGAGTCCGAGTCGACCGCCGGAGTCGACGACCTTGACGACAGCGTCAACACCCCGCTGCTGG
CTGCCGCGAACTCTCGCGGCTATGGCGCGCGCGAAAGCCGTCAGAGGTCTGCTCAGGGACCCTTTCGCCAGCCCT
CTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail