Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5198
Gene name
Locationscaffold_42:16726..18422
Strand+
Gene length (bp)1696
Transcript length (bp)1587
Coding sequence length (bp)1584
Protein length (aa) 528

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01694 Rhomboid Rhomboid family 2.8E-35 287 428

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C8VCL5|Y0929_EMENI Uncharacterized rhomboid protein AN10929 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10929 PE=3 SV=1 178 524 3.0E-135
sp|Q8VZ48|RBL6_ARATH RHOMBOID-like protein 6, mitochondrial OS=Arabidopsis thaliana GN=RBL6 PE=2 SV=1 287 518 2.0E-27
sp|Q9LYP1|RBL3_ARATH RHOMBOID-like protein 3 OS=Arabidopsis thaliana GN=RBL3 PE=2 SV=1 287 518 2.0E-27
sp|Q0WQX7|RBL1_ARATH RHOMBOID-like protein 1 OS=Arabidopsis thaliana GN=RBL1 PE=2 SV=1 292 528 3.0E-27
sp|F4JBM4|RBL4_ARATH RHOMBOID-like protein 4 OS=Arabidopsis thaliana GN=RBL4 PE=2 SV=1 281 518 4.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C8VCL5|Y0929_EMENI Uncharacterized rhomboid protein AN10929 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10929 PE=3 SV=1 178 524 3.0E-135
sp|Q8VZ48|RBL6_ARATH RHOMBOID-like protein 6, mitochondrial OS=Arabidopsis thaliana GN=RBL6 PE=2 SV=1 287 518 2.0E-27
sp|Q9LYP1|RBL3_ARATH RHOMBOID-like protein 3 OS=Arabidopsis thaliana GN=RBL3 PE=2 SV=1 287 518 2.0E-27
sp|Q0WQX7|RBL1_ARATH RHOMBOID-like protein 1 OS=Arabidopsis thaliana GN=RBL1 PE=2 SV=1 292 528 3.0E-27
sp|F4JBM4|RBL4_ARATH RHOMBOID-like protein 4 OS=Arabidopsis thaliana GN=RBL4 PE=2 SV=1 281 518 4.0E-27
sp|Q6GMF8|RHDF1_DANRE Inactive rhomboid protein 1 OS=Danio rerio GN=rhbdf1 PE=2 SV=1 255 520 5.0E-25
sp|Q6PIX5|RHDF1_MOUSE Inactive rhomboid protein 1 OS=Mus musculus GN=Rhbdf1 PE=1 SV=2 255 520 3.0E-23
sp|B0VX73|RHDF1_CALJA Inactive rhomboid protein 1 OS=Callithrix jacchus GN=RHBDF1 PE=3 SV=1 255 520 5.0E-23
sp|Q499S9|RHDF1_RAT Inactive rhomboid protein 1 OS=Rattus norvegicus GN=Rhbdf1 PE=2 SV=1 255 520 6.0E-23
sp|Q96CC6|RHDF1_HUMAN Inactive rhomboid protein 1 OS=Homo sapiens GN=RHBDF1 PE=1 SV=2 255 520 7.0E-23
sp|B1MT31|RHDF1_CALMO Inactive rhomboid protein 1 OS=Callicebus moloch GN=RHBDF1 PE=3 SV=1 255 520 7.0E-23
sp|A9L8T6|RHDF1_PAPAN Inactive rhomboid protein 1 OS=Papio anubis GN=RHBDF1 PE=3 SV=1 255 520 8.0E-23
sp|A7YWH9|RHDF1_BOVIN Inactive rhomboid protein 1 OS=Bos taurus GN=RHBDF1 PE=2 SV=1 255 520 2.0E-22
sp|Q9CAN1|RBL2_ARATH RHOMBOID-like protein 2 OS=Arabidopsis thaliana GN=RBL2 PE=1 SV=1 287 430 6.0E-22
sp|Q00M95|RHDF2_CANLF Inactive rhomboid protein 2 OS=Canis lupus familiaris GN=RHBDF2 PE=2 SV=1 255 426 8.0E-20
sp|A0JPA1|RHDF2_XENTR Inactive rhomboid protein 2 OS=Xenopus tropicalis GN=rhbdf2 PE=2 SV=1 255 526 8.0E-20
sp|Q6PJF5|RHDF2_HUMAN Inactive rhomboid protein 2 OS=Homo sapiens GN=RHBDF2 PE=1 SV=2 255 426 3.0E-19
sp|Q80WQ6|RHDF2_MOUSE Inactive rhomboid protein 2 OS=Mus musculus GN=Rhbdf2 PE=1 SV=1 255 426 3.0E-19
sp|F4I8K2|RBL8_ARATH RHOMBOID-like protein 8 OS=Arabidopsis thaliana GN=KOM PE=2 SV=1 287 518 3.0E-18
sp|Q9SSR0|RBL5_ARATH RHOMBOID-like protein 5 OS=Arabidopsis thaliana GN=RBL5 PE=3 SV=1 287 430 1.0E-16
sp|O82756|RBL7_ARATH RHOMBOID-like protein 7 OS=Arabidopsis thaliana GN=RBL7 PE=3 SV=1 287 412 2.0E-13
sp|Q695T8|RHBL4_TOXGO Rhomboid-like protease 4 OS=Toxoplasma gondii GN=ROM4 PE=2 SV=1 287 459 4.0E-12
sp|P58872|RHBL3_HUMAN Rhomboid-related protein 3 OS=Homo sapiens GN=RHBDL3 PE=2 SV=1 290 426 6.0E-12
sp|O75783|RHBL1_HUMAN Rhomboid-related protein 1 OS=Homo sapiens GN=RHBDL1 PE=2 SV=1 292 437 7.0E-12
sp|Q76NQ1|RHDF1_DROME Inactive rhomboid protein 1 OS=Drosophila melanogaster GN=rho-5 PE=2 SV=1 288 426 7.0E-12
sp|P54493|GLUP_BACSU Rhomboid protease GluP OS=Bacillus subtilis (strain 168) GN=gluP PE=1 SV=2 290 423 2.0E-11
sp|Q8VC82|RHBL1_MOUSE Rhomboid-related protein 1 OS=Mus musculus GN=Rhbdl1 PE=2 SV=1 292 437 4.0E-11
sp|P58873|RHBL3_MOUSE Rhomboid-related protein 3 OS=Mus musculus GN=Rhbdl3 PE=2 SV=1 290 428 8.0E-11
sp|Q6IUY1|RHBL3_TOXGO Rhomboid-like protease 3 OS=Toxoplasma gondii GN=ROM3 PE=2 SV=1 259 424 1.0E-10
sp|Q695T9|RHBL2_TOXGO Rhomboid-like protease 2 OS=Toxoplasma gondii GN=ROM2 PE=2 SV=1 292 423 2.0E-09
sp|P20350|RHOM_DROME Protein rhomboid OS=Drosophila melanogaster GN=rho PE=1 SV=2 274 426 8.0E-09
sp|O88779|RHBL1_RAT Rhomboid-related protein 1 (Fragment) OS=Rattus norvegicus GN=Rhbdl1 PE=2 SV=1 299 437 2.0E-08
sp|F4ICF4|RBL10_ARATH RHOMBOID-like protein 10, chloroplastic OS=Arabidopsis thaliana GN=RBL10 PE=2 SV=1 287 421 3.0E-08
sp|P96617|YDCA_BACSU Putative rhomboid protease YdcA OS=Bacillus subtilis (strain 168) GN=ydcA PE=3 SV=1 290 375 6.0E-08
sp|P46116|AARA_PROST Rhomboid protease AarA OS=Providencia stuartii GN=aarA PE=1 SV=1 281 433 3.0E-06
sp|Q695U0|RHBL1_TOXGO Rhomboid-like protease 1 OS=Toxoplasma gondii GN=ROM1 PE=2 SV=1 287 423 5.0E-06
sp|Q9FFX0|RBL9_ARATH RHOMBOID-like protein 9, chloroplastic OS=Arabidopsis thaliana GN=RBL9 PE=2 SV=1 290 422 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0004252 serine-type endopeptidase activity Yes
GO:0016787 hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0004175 endopeptidase activity No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0008233 peptidase activity No
GO:0003674 molecular_function No
GO:0008236 serine-type peptidase activity No
GO:0017171 serine hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 180 198 18
2 291 313 22
3 330 352 22
4 356 375 19
5 387 406 19
6 472 494 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5198
MAFNDRLKNDHFNDDDRLRDPAPTPYQTAHFPSPHSTPAPSFHSVDPVRPLPPSQTPRPYGATHDQPPRLGHSPF
ESVFDDPVRLNGPKPYAAGSSSPAFYHDTGYYGSGGGPISAGPHVAEEIPLQDHPASKNDGVTDHVYDALGPDGN
ARPSSRRRSRGKVRVGELGMFGANRKRIPWVVYLFTVVQIAVFIAEIIKNGVLTGSPIMIKPQFNPMIGPSTQVM
INMGARFVACMHNVPEIQGSTVPVLFLCPNATSNDQTCPLSEVCGFGGVPNPTFNNADQKPEPNQWFRFITPIFM
HAGLIHIGFNLLLQLTLAKEMEMAIGPMRFFLVYMSAGIFGFVLGGNFAAPALPSTGASGSLFGIIALVLLDLLY
SWKERRNPVKDLLFLILDMVISFALGLLPGLDNFAHIGGFIMGLALGICVLHSPNSLRKRLGNGTPYSAVLPDNN
GHPPSQRFKGPIGFFKGRKPLWWLWWIVRAGVLTVAIAVFIVLLNNFYTTRSTCTWCKYLSCIPVSNWCELGTIR
QES
Coding >Ophio5|5198
ATGGCCTTCAACGACCGCCTCAAAAACGACCATTTCAACGACGATGATCGCCTACGTGACCCTGCTCCGACTCCA
TATCAAACTGCCCACTTCCCCTCGCCGCACTCGACGCCTGCGCCGTCATTCCACTCGGTCGATCCCGTGCGGCCG
CTGCCGCCCTCGCAGACGCCACGACCCTACGGTGCTACACACGATCAGCCTCCGCGATTGGGCCACTCGCCCTTC
GAATCAGTCTTCGACGACCCTGTTCGCCTCAACGGCCCGAAGCCGTACGCCGCCGGCTCGTCTTCACCGGCCTTT
TACCATGACACCGGCTATTACGGCTCTGGAGGCGGCCCCATCTCCGCAGGGCCTCATGTGGCCGAAGAGATACCC
CTGCAAGACCATCCGGCTTCAAAAAACGACGGCGTGACGGACCACGTGTATGATGCGCTGGGTCCCGACGGCAAT
GCGAGACCTTCTTCCCGCAGACGCAGTAGGGGCAAGGTCCGTGTGGGCGAGCTGGGCATGTTTGGCGCGAACAGG
AAGCGCATTCCTTGGGTCGTCTACCTTTTCACAGTCGTCCAGATCGCCGTCTTCATCGCCGAGATTATCAAGAAC
GGCGTCCTGACCGGGTCACCAATCATGATCAAGCCTCAGTTCAACCCGATGATCGGGCCGTCGACCCAGGTCATG
ATCAACATGGGTGCCCGATTCGTCGCCTGCATGCACAACGTACCGGAGATCCAGGGTTCCACCGTCCCAGTTCTG
TTTCTCTGCCCAAACGCAACCAGCAACGATCAGACGTGTCCGCTGTCCGAAGTCTGCGGCTTCGGCGGCGTCCCG
AACCCGACCTTCAACAACGCGGACCAGAAACCCGAGCCGAACCAGTGGTTCCGCTTCATCACGCCCATCTTTATG
CACGCCGGTCTCATTCACATTGGCTTTAACCTGCTTCTGCAGCTCACGCTCGCCAAGGAAATGGAGATGGCCATT
GGTCCCATGCGCTTCTTCCTCGTCTACATGAGCGCTGGAATCTTTGGCTTCGTCTTGGGCGGCAACTTTGCCGCG
CCCGCGCTACCCTCCACCGGCGCCTCTGGCTCCCTCTTTGGCATCATCGCCTTGGTGCTTCTCGACCTCCTTTAC
TCGTGGAAGGAGCGGCGAAACCCGGTCAAGGACTTACTGTTTCTCATTCTTGACATGGTCATTTCTTTCGCCCTG
GGTCTGTTGCCGGGTCTCGACAACTTTGCCCACATTGGCGGCTTCATCATGGGACTAGCCCTCGGCATCTGCGTC
CTTCATTCGCCCAATTCCCTGCGCAAGAGGCTGGGTAACGGTACGCCCTACTCCGCCGTTCTCCCGGACAACAAC
GGCCACCCACCGTCGCAGCGCTTCAAGGGACCCATTGGCTTCTTCAAGGGGCGCAAGCCGCTCTGGTGGCTCTGG
TGGATTGTCAGGGCTGGTGTCCTCACCGTCGCCATCGCCGTCTTCATCGTTCTGCTTAACAATTTTTACACGACG
CGGTCCACGTGCACTTGGTGCAAGTACCTGAGCTGCATTCCCGTTAGCAATTGGTGCGAACTAGGAACCATTCGT
CAGGAGAGC
Transcript >Ophio5|5198
ATGGCCTTCAACGACCGCCTCAAAAACGACCATTTCAACGACGATGATCGCCTACGTGACCCTGCTCCGACTCCA
TATCAAACTGCCCACTTCCCCTCGCCGCACTCGACGCCTGCGCCGTCATTCCACTCGGTCGATCCCGTGCGGCCG
CTGCCGCCCTCGCAGACGCCACGACCCTACGGTGCTACACACGATCAGCCTCCGCGATTGGGCCACTCGCCCTTC
GAATCAGTCTTCGACGACCCTGTTCGCCTCAACGGCCCGAAGCCGTACGCCGCCGGCTCGTCTTCACCGGCCTTT
TACCATGACACCGGCTATTACGGCTCTGGAGGCGGCCCCATCTCCGCAGGGCCTCATGTGGCCGAAGAGATACCC
CTGCAAGACCATCCGGCTTCAAAAAACGACGGCGTGACGGACCACGTGTATGATGCGCTGGGTCCCGACGGCAAT
GCGAGACCTTCTTCCCGCAGACGCAGTAGGGGCAAGGTCCGTGTGGGCGAGCTGGGCATGTTTGGCGCGAACAGG
AAGCGCATTCCTTGGGTCGTCTACCTTTTCACAGTCGTCCAGATCGCCGTCTTCATCGCCGAGATTATCAAGAAC
GGCGTCCTGACCGGGTCACCAATCATGATCAAGCCTCAGTTCAACCCGATGATCGGGCCGTCGACCCAGGTCATG
ATCAACATGGGTGCCCGATTCGTCGCCTGCATGCACAACGTACCGGAGATCCAGGGTTCCACCGTCCCAGTTCTG
TTTCTCTGCCCAAACGCAACCAGCAACGATCAGACGTGTCCGCTGTCCGAAGTCTGCGGCTTCGGCGGCGTCCCG
AACCCGACCTTCAACAACGCGGACCAGAAACCCGAGCCGAACCAGTGGTTCCGCTTCATCACGCCCATCTTTATG
CACGCCGGTCTCATTCACATTGGCTTTAACCTGCTTCTGCAGCTCACGCTCGCCAAGGAAATGGAGATGGCCATT
GGTCCCATGCGCTTCTTCCTCGTCTACATGAGCGCTGGAATCTTTGGCTTCGTCTTGGGCGGCAACTTTGCCGCG
CCCGCGCTACCCTCCACCGGCGCCTCTGGCTCCCTCTTTGGCATCATCGCCTTGGTGCTTCTCGACCTCCTTTAC
TCGTGGAAGGAGCGGCGAAACCCGGTCAAGGACTTACTGTTTCTCATTCTTGACATGGTCATTTCTTTCGCCCTG
GGTCTGTTGCCGGGTCTCGACAACTTTGCCCACATTGGCGGCTTCATCATGGGACTAGCCCTCGGCATCTGCGTC
CTTCATTCGCCCAATTCCCTGCGCAAGAGGCTGGGTAACGGTACGCCCTACTCCGCCGTTCTCCCGGACAACAAC
GGCCACCCACCGTCGCAGCGCTTCAAGGGACCCATTGGCTTCTTCAAGGGGCGCAAGCCGCTCTGGTGGCTCTGG
TGGATTGTCAGGGCTGGTGTCCTCACCGTCGCCATCGCCGTCTTCATCGTTCTGCTTAACAATTTTTACACGACG
CGGTCCACGTGCACTTGGTGCAAGTACCTGAGCTGCATTCCCGTTAGCAATTGGTGCGAACTAGGAACCATTCGT
CAGGAGAGCTGA
Gene >Ophio5|5198
ATGGCCTTCAACGACCGCCTCAAAAACGACCATTTCAACGACGATGATCGCCTACGTGACCCTGCTCCGACTCCA
TATCAAACTGCCCACTTCCCCTCGCCGCACTCGACGCCTGCGCCGTCATTCCACTCGGTCGATCCCGTGCGGCCG
CTGCCGCCCTCGCAGACGCCACGACCCTACGGTGCTACACACGATCAGCCTCCGCGATTGGGCCACTCGCCCTTC
GAATCAGTCTTCGACGACCCTGTTCGCCTCAACGGCCCGAAGCCGTACGCCGCCGGCTCGTCTTCACCGGCCTTT
TACCATGACACCGGCTATTACGGCTCTGGAGGCGGCCCCATCTCCGCAGGGCCTCATGTGGCCGAAGAGATACCC
CTGCAAGACCATCCGGCTTCAAAAAACGACGGCGTGACGGACCACGTGTATGATGCGCTGGGTCCCGACGGCAAT
GCGAGACCTTCTTCCCGCAGACGCAGTAGGGGCAAGGTCCGTGTGGGCGAGCTGGGCATGTTTGGCGCGAACAGG
AAGCGCATTCCTTGGGTCGTCTACCTTTTCACAGTCGTCCAGATCGCCGTCTTCATCGCCGAGATTATCAAGAAC
GGTTCGGCTTCCCCGTTACCCTGCCTAAGCTCTTTGCTGACGTTGTCCGCCTGTAGGCGTCCTGACCGGGTCACC
AATCATGATCAAGCCTCAGTTCAACCCGATGATCGGGCCGTCGACCCAGGTCATGATCAACATGGGTGCCCGATT
CGTCGCCTGCATGCACAACGTACCGGAGATCCAGGGTTCCACCGTCCCAGTTCTGTTTCTCTGCCCAAACGCAAC
CAGCAACGATCAGACGTGTCCGCTGTCCGAAGTCTGCGGCTTCGGCGGCGTCCCGAACCCGACCTTCAACAACGC
GGACCAGAAACCCGAGCCGAACCAGTGGTTCCGCTTCATCACGCCCATCTTTATGCACGCCGGTCTCATTCACAT
TGGCTTTAACCTGCTTCTGCAGCTCACGCTCGCCAAGGAAATGGAGATGGCCATTGGTCCCATGCGCTTCTTCCT
CGTCTACATGAGCGCTGGAATCTTTGGCTTCGTCTTGGGCGGCAACTTTGCCGCGCCCGCGCTACCCTCCACCGG
CGCCTCTGGCTCCCTCTTTGGCATCATCGCCTTGGTGCTTCTCGACCTCCTTTACTCGTGGAAGGAGCGGCGAAA
CCCGGTCAAGGACTTACTGTTTCTCATTCTTGACATGGTCATTTCTTTCGCCCTGGGTCTGTTGCCGGGTCTCGA
CAACTTTGCCCACATTGGCGGCTTCATCATGGGACTAGCCCTCGGCATCTGCGTCCTTCATTCGCCCAATTCCCT
GCGCAAGAGGCTGGGTAACGGTACGCCCTACTCCGCCGTTCTCCCGGACAACAACGGCCACCCACCGTCGCAGCG
CTTCAAGGGACCCATTGGCTTCTTCAAGGGGCGCAAGCCGCTCTGGTGGCTCTGGTGGATTGTCAGGGCTGGTGT
CCTCACCGTCGCCATCGCCGTCTTCATCGTTCTGCTTAACAATTTTTACACGACGCGGTCCACGTGCACTTGGTG
CAAGTACCTGAGCTGCATTGTGCGTTCCCCCCCCCCCCCCCAAGCCGTCGACGAGAGGCTAACTGAAGATCAGCC
CGTTAGCAATTGGTGCGAACTAGGAACCATTCGTCAGGAGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail