Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5191
Gene name
Locationscaffold_419:16034..17131
Strand+
Gene length (bp)1097
Transcript length (bp)867
Coding sequence length (bp)864
Protein length (aa) 288

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01083 Cutinase Cutinase 1.7E-44 22 221
PF08237 PE-PPE PE-PPE domain 2.8E-06 63 113

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59893|AXE2_TALPU Acetylxylan esterase 2 OS=Talaromyces purpurogenus GN=axe-2 PE=1 SV=1 24 222 3.0E-20
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 1 283 1.0E-17
sp|P9WP39|CUT3_MYCTU Probable cutinase cut3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cut3 PE=1 SV=1 29 251 1.0E-09
sp|P0A537|CUT3_MYCBO Probable cutinase cut3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cut3 PE=3 SV=1 29 251 1.0E-09
sp|P9WP38|CUT3_MYCTO Probable cutinase cut3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cut3 PE=3 SV=1 29 251 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59893|AXE2_TALPU Acetylxylan esterase 2 OS=Talaromyces purpurogenus GN=axe-2 PE=1 SV=1 24 222 3.0E-20
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 1 283 1.0E-17
sp|P9WP39|CUT3_MYCTU Probable cutinase cut3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cut3 PE=1 SV=1 29 251 1.0E-09
sp|P0A537|CUT3_MYCBO Probable cutinase cut3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cut3 PE=3 SV=1 29 251 1.0E-09
sp|P9WP38|CUT3_MYCTO Probable cutinase cut3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cut3 PE=3 SV=1 29 251 1.0E-09
sp|P9WP41|CUT2_MYCTU Probable cutinase cut2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cut2 PE=1 SV=1 26 221 4.0E-07
sp|P9WP40|CUT2_MYCTO Probable cutinase cut2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cut2 PE=3 SV=1 26 221 4.0E-07
sp|P63882|CUT2_MYCBO Probable cutinase cut2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cut2 PE=3 SV=1 26 221 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5191
MRRTILAVAALVAGTAAESCISGLYMVVARGTKEPEGAGMTGSVTESIARKVPGSQVVPLRYPASLSNPDYQDSV
ADGVRQMQTTIRDYVKVCPRSKVAVFGYSQGAHVAMDALCGSSGMAGFGNSTPIGIDLMTKNIVAVVLFGDPSHV
VNVTYDRGTSVRNGIFNRTSSSVQACNAFADRIVSYCDEGDYYCDRGRKRTVHSLYMSRYGAEVRRFVVDRFKNA
TDEQGGAKKHLSSTSRMAAMPTSTAPPSTSNGGGPGGEGGADRAGQARGSTSSAASDYRNSRP
Coding >Ophio5|5191
ATGCGTCGAACCATCCTTGCCGTGGCCGCTCTCGTCGCAGGCACGGCGGCCGAATCATGCATATCCGGCCTCTAC
ATGGTCGTCGCCCGCGGTACCAAGGAGCCCGAGGGCGCTGGCATGACGGGCTCAGTGACGGAATCCATCGCCCGG
AAGGTGCCCGGCTCTCAAGTTGTGCCTCTGCGGTACCCGGCGAGCCTGTCAAACCCCGACTATCAAGACTCGGTC
GCCGATGGCGTCCGGCAGATGCAGACGACGATACGCGACTACGTCAAGGTCTGTCCGCGGTCCAAGGTGGCCGTC
TTTGGCTATTCTCAGGGCGCTCACGTGGCCATGGATGCTCTCTGCGGCTCCTCAGGCATGGCCGGTTTTGGGAAT
TCGACGCCAATCGGCATTGACTTGATGACGAAGAACATCGTTGCCGTTGTATTATTCGGTGATCCATCTCATGTC
GTCAACGTCACCTACGACAGGGGGACCAGCGTCCGGAACGGGATCTTCAACCGCACCAGCAGCTCGGTACAAGCC
TGCAACGCCTTTGCCGACCGCATCGTCTCGTACTGCGACGAAGGAGACTATTACTGCGATAGGGGCCGCAAGAGG
ACGGTGCACAGTCTCTACATGTCGCGCTATGGCGCCGAGGTGCGGCGATTCGTCGTCGACAGGTTCAAGAATGCG
ACGGACGAGCAGGGCGGCGCCAAGAAGCATCTCAGCTCGACATCACGCATGGCGGCCATGCCCACGAGCACAGCC
CCGCCAAGTACGAGCAACGGAGGAGGACCGGGCGGAGAAGGCGGAGCAGACAGGGCAGGCCAAGCCCGCGGCAGC
ACCTCGTCGGCGGCCAGCGATTATAGGAATAGCAGGCCG
Transcript >Ophio5|5191
ATGCGTCGAACCATCCTTGCCGTGGCCGCTCTCGTCGCAGGCACGGCGGCCGAATCATGCATATCCGGCCTCTAC
ATGGTCGTCGCCCGCGGTACCAAGGAGCCCGAGGGCGCTGGCATGACGGGCTCAGTGACGGAATCCATCGCCCGG
AAGGTGCCCGGCTCTCAAGTTGTGCCTCTGCGGTACCCGGCGAGCCTGTCAAACCCCGACTATCAAGACTCGGTC
GCCGATGGCGTCCGGCAGATGCAGACGACGATACGCGACTACGTCAAGGTCTGTCCGCGGTCCAAGGTGGCCGTC
TTTGGCTATTCTCAGGGCGCTCACGTGGCCATGGATGCTCTCTGCGGCTCCTCAGGCATGGCCGGTTTTGGGAAT
TCGACGCCAATCGGCATTGACTTGATGACGAAGAACATCGTTGCCGTTGTATTATTCGGTGATCCATCTCATGTC
GTCAACGTCACCTACGACAGGGGGACCAGCGTCCGGAACGGGATCTTCAACCGCACCAGCAGCTCGGTACAAGCC
TGCAACGCCTTTGCCGACCGCATCGTCTCGTACTGCGACGAAGGAGACTATTACTGCGATAGGGGCCGCAAGAGG
ACGGTGCACAGTCTCTACATGTCGCGCTATGGCGCCGAGGTGCGGCGATTCGTCGTCGACAGGTTCAAGAATGCG
ACGGACGAGCAGGGCGGCGCCAAGAAGCATCTCAGCTCGACATCACGCATGGCGGCCATGCCCACGAGCACAGCC
CCGCCAAGTACGAGCAACGGAGGAGGACCGGGCGGAGAAGGCGGAGCAGACAGGGCAGGCCAAGCCCGCGGCAGC
ACCTCGTCGGCGGCCAGCGATTATAGGAATAGCAGGCCGTAG
Gene >Ophio5|5191
ATGCGTCGAACCATCCTTGCCGTGGCCGCTCTCGTCGCAGGCACGGCGGCCGAATCATGCATATCCGGCCTCTAC
ATGGTCGTCGCCCGCGGTACCAAGGAGCCCGAGGGCGCTGGCATGACGGGCTCAGTGACGGAATCCATCGCCCGG
AAGGTGCCCGGCTCTCAAGTTGTGCCTCTGCGGTACCCGGCGAGCCTGTCAAACCCCGACTATCAAGACTCGGTC
GCCGATGGCGTCCGGCAGATGCAGACGACGATACGCGACTACGTCAAGGTCTGTCCGCGGTCCAAGGTGGCCGTC
TTTGGCTATTCTCAGGTAACCGACTCTCCGTCCCCACGTCGACGCTCAACCGCTGACTCTGGACTGCAGGGCGCT
CACGTGGCCATGGATGCTCTCTGCGGCTCCTCAGGCATGGCCGGTTTTGGGAATTCGACGCCAATCGGCATTGAC
TTGATGACGAAGAACAGTGGGTGTCCCATTTCTCGATCCTCCCTGCAGATGGCTCATCTAACTTGCCCTGGCGCT
GCACAGTCGTTGCCGTTGTATTATTCGGTGATCCATCTCATGTCGTCAACGTCACCTACGACAGGGGGACCAGCG
TCCGGAACGGGGTACGTGGGCCAACAATGGCACGAAAATCACGTACCTACTGACGGGCCGGCAGATCTTCAACCG
CACCAGCAGCTCGGTACAAGCCTGCAACGCCTTTGCCGACCGCATCGTCTCGTACTGCGACGAAGGAGACTATTA
CTGCGATAGGGGCCGCAAGAGGACGGTGCACAGTCTCTACATGTCGCGCTATGGCGCCGAGGTGCGGCGATTCGT
CGTCGACAGGTTCAAGAATGCGACGGACGAGCAGGGCGGCGCCAAGAAGCATCTCAGCTCGACATCACGCATGGC
GGCCATGCCCACGAGCACAGCCCCGCCAAGTACGAGCAACGGAGGAGGACCGGGCGGAGAAGGCGGAGCAGACAG
GGCAGGCCAAGCCCGCGGCAGCACCTCGTCGGCGGCCAGGTCTGTCAGCGGCTTCTATTCTGGGACCTTGATCAT
GGTTCTGATGGCTGGTCTTCAGCGATTATAGGAATAGCAGGCCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail