Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5189
Gene name
Locationscaffold_419:12673..15111
Strand-
Gene length (bp)2438
Transcript length (bp)2013
Coding sequence length (bp)2010
Protein length (aa) 670

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 6.9E-37 185 587

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 132 654 2.0E-58
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 212 641 4.0E-54
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 129 631 4.0E-39
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 167 633 2.0E-37
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 202 609 5.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 132 654 2.0E-58
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 212 641 4.0E-54
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 129 631 4.0E-39
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 167 633 2.0E-37
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 202 609 5.0E-20
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 202 609 5.0E-20
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 198 495 5.0E-16
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 213 480 6.0E-15
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 198 464 1.0E-14
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 185 433 3.0E-14
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 199 519 4.0E-14
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 199 519 4.0E-14
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 198 484 1.0E-13
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 198 484 1.0E-13
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 235 553 2.0E-13
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 121 497 3.0E-12
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 141 501 3.0E-12
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 197 666 1.0E-11
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 198 338 2.0E-11
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 198 499 9.0E-11
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 201 474 2.0E-10
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 201 504 1.0E-09
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 198 499 1.0E-09
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 201 504 1.0E-09
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 237 505 3.0E-09
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 224 469 4.0E-09
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 224 469 4.0E-09
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 237 505 5.0E-09
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 197 436 8.0E-09
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 180 457 9.0E-09
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 144 481 9.0E-09
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 197 434 2.0E-07
sp|A8AEE4|MDTD_CITK8 Putative multidrug resistance protein MdtD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtD PE=3 SV=1 198 665 3.0E-07
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 185 523 4.0E-07
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 180 451 5.0E-07
sp|P37594|SMVA_SALTY Methyl viologen resistance protein SmvA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=smvA PE=3 SV=2 197 387 7.0E-07
sp|D0ZXQ3|SMVA_SALT1 Methyl viologen resistance protein SmvA OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=smvA PE=1 SV=1 197 387 7.0E-07
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 261 513 1.0E-06
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 261 513 1.0E-06
sp|P52600|EMRY_ECOLI Probable multidrug resistance protein EmrY OS=Escherichia coli (strain K12) GN=emrY PE=2 SV=1 198 449 3.0E-06
sp|P13924|TCR_STRAG Tetracycline resistance protein OS=Streptococcus agalactiae GN=tet PE=3 SV=1 198 380 3.0E-06
sp|P23054|TCRB_BACSU Tetracycline resistance protein OS=Bacillus subtilis (strain 168) GN=tetB PE=3 SV=1 198 437 6.0E-06
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 180 584 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

Domain # Start End Length
1 244 266 22
2 270 292 22
3 305 327 22
4 332 354 22
5 367 389 22
6 399 421 22
7 441 463 22
8 474 496 22
9 503 522 19
10 532 554 22
11 575 597 22
12 612 634 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5189
MRVDPFFKSDADTQHNTDACFTFWPLIQPHQLRHHYFRGLPTETSERRERTSRDNKPGPRTSPPALVRSGSADRV
PDPDPDPDEASTKSQPRPRPRPGGLVGFSMFDGQRLNMMKNLSPIKRLNRAAVDEPSSSSVGQPNHGESTSSGDD
SDGVLVTDVKLLGRVRPSVFSGPLAEAAFVLTVVLSMMTSEYFVGGFDVILPTIADALAIPPSARTWPAGVVTLT
TAALLQPSARLCDIYGSRLVFLFGQAWLMAWSIVTGFSVNTSMLIVCRAMQGIGAAAFLPAGLALLGHTYRPGPR
KNVAFSIYGAFACVGFYFGIFIGAVSAEFLTWRWYFWIGAIICFINLASGLLTIPRRLPDVDPDARMDWLGVITI
VPGLVLVVFAFTDAGEVPGGWRNPLIYATFIVGVIFLAVAVYVQGWVSAQPLLSPALFKPRYIKRLMLSLFCYYG
VFGIFLLYTSFYIENILHIKPLLTAAWYTPLAVGGMFLAIGGGLVLHIVPNRILLTISGLGFLLSVLLFALIPGP
DDGKSISFIYWAYVFSAMLGGTIGIDITFNVTNVFITTAMPRRLQAAASGLINSLLYLGVAFWLGVAQTAISATE
ERRDGGLDAAAQYRIAFWTGVALAGVALCLTLTIKIGQAEADMTADEKAEQEREPMEADDRRTTEQTVPT
Coding >Ophio5|5189
ATGCGGGTAGATCCATTTTTCAAATCGGATGCAGATACACAACACAACACCGACGCCTGTTTCACCTTTTGGCCG
CTCATCCAGCCTCACCAGCTTCGGCATCACTATTTCCGCGGCCTGCCGACAGAGACGTCGGAGCGCCGAGAGCGG
ACCAGCCGCGACAATAAACCGGGTCCCCGGACCTCTCCCCCGGCTTTGGTCCGCTCGGGGTCCGCGGACCGCGTT
CCGGACCCGGACCCCGACCCCGACGAGGCGAGTACAAAAAGCCAGCCACGACCACGACCACGACCAGGTGGCCTC
GTTGGCTTCTCGATGTTTGATGGACAACGACTCAACATGATGAAGAACTTGTCGCCCATCAAGCGGCTCAATCGG
GCCGCCGTCGACGAGCCCTCGTCGTCTAGCGTTGGTCAGCCCAACCATGGCGAATCCACTTCGTCTGGCGACGAC
AGCGACGGCGTCTTGGTGACGGATGTCAAGCTTCTGGGCCGGGTCCGTCCCTCTGTCTTCTCCGGTCCTCTCGCC
GAAGCAGCCTTCGTTCTCACCGTCGTTCTCTCCATGATGACGAGCGAGTACTTTGTTGGCGGCTTCGACGTCATT
CTGCCCACCATCGCCGACGCTCTCGCTATTCCGCCTAGTGCCCGCACCTGGCCGGCCGGCGTCGTCACCTTGACG
ACGGCCGCGCTGTTACAGCCCTCGGCCCGGCTCTGCGACATCTACGGCAGCCGGCTCGTCTTCTTGTTCGGCCAG
GCCTGGCTGATGGCCTGGTCCATCGTCACCGGCTTCAGCGTCAATACGTCCATGCTCATCGTCTGCCGCGCCATG
CAGGGCATCGGAGCCGCCGCCTTCCTGCCGGCCGGTCTCGCCCTGCTGGGCCATACCTACCGCCCGGGCCCGCGC
AAGAATGTGGCCTTTTCCATATACGGCGCCTTCGCCTGCGTCGGCTTCTACTTTGGCATCTTCATAGGCGCAGTC
TCGGCCGAGTTCCTTACCTGGCGCTGGTACTTTTGGATCGGCGCCATCATCTGCTTCATCAACCTGGCCTCTGGC
CTGCTGACGATCCCTCGTCGTCTCCCGGACGTGGATCCGGACGCCCGCATGGACTGGCTGGGCGTCATCACCATC
GTCCCGGGTCTCGTCCTCGTTGTCTTCGCCTTTACGGATGCCGGCGAGGTTCCCGGCGGCTGGCGCAACCCCCTG
ATTTACGCCACCTTTATCGTGGGCGTCATCTTCCTCGCCGTGGCCGTCTACGTCCAGGGCTGGGTCTCGGCTCAG
CCGCTGCTTTCCCCAGCGCTGTTCAAGCCCAGGTACATTAAGCGCCTGATGCTGTCGCTGTTTTGCTACTACGGC
GTCTTTGGAATCTTCCTTTTGTACACGAGCTTCTACATCGAAAACATTCTCCATATCAAACCGCTTCTGACGGCG
GCCTGGTACACGCCTCTCGCCGTCGGCGGCATGTTCTTGGCCATTGGCGGCGGCCTGGTTCTGCACATTGTGCCG
AACCGCATTCTCCTAACTATCTCGGGCCTCGGCTTCCTGCTATCGGTGCTCCTGTTCGCCCTGATACCGGGCCCG
GACGACGGCAAGTCCATCAGCTTCATCTACTGGGCCTACGTCTTCTCGGCCATGCTGGGGGGCACCATCGGCATC
GACATCACCTTCAACGTGACCAACGTCTTCATCACGACGGCCATGCCGCGCCGTCTCCAGGCCGCCGCCAGTGGG
CTCATCAACAGCCTACTGTACCTGGGCGTCGCCTTTTGGCTGGGTGTCGCCCAGACGGCCATTTCGGCGACGGAG
GAGAGGCGCGACGGCGGACTGGATGCGGCAGCCCAGTACCGGATCGCGTTCTGGACGGGCGTGGCGCTGGCAGGC
GTGGCGCTGTGTCTGACGCTGACGATCAAGATTGGCCAGGCCGAGGCGGACATGACGGCCGACGAGAAGGCCGAG
CAGGAGCGCGAGCCCATGGAGGCGGACGACCGGAGGACGACGGAGCAGACTGTGCCGACG
Transcript >Ophio5|5189
ATGCGGGTAGATCCATTTTTCAAATCGGATGCAGATACACAACACAACACCGACGCCTGTTTCACCTTTTGGCCG
CTCATCCAGCCTCACCAGCTTCGGCATCACTATTTCCGCGGCCTGCCGACAGAGACGTCGGAGCGCCGAGAGCGG
ACCAGCCGCGACAATAAACCGGGTCCCCGGACCTCTCCCCCGGCTTTGGTCCGCTCGGGGTCCGCGGACCGCGTT
CCGGACCCGGACCCCGACCCCGACGAGGCGAGTACAAAAAGCCAGCCACGACCACGACCACGACCAGGTGGCCTC
GTTGGCTTCTCGATGTTTGATGGACAACGACTCAACATGATGAAGAACTTGTCGCCCATCAAGCGGCTCAATCGG
GCCGCCGTCGACGAGCCCTCGTCGTCTAGCGTTGGTCAGCCCAACCATGGCGAATCCACTTCGTCTGGCGACGAC
AGCGACGGCGTCTTGGTGACGGATGTCAAGCTTCTGGGCCGGGTCCGTCCCTCTGTCTTCTCCGGTCCTCTCGCC
GAAGCAGCCTTCGTTCTCACCGTCGTTCTCTCCATGATGACGAGCGAGTACTTTGTTGGCGGCTTCGACGTCATT
CTGCCCACCATCGCCGACGCTCTCGCTATTCCGCCTAGTGCCCGCACCTGGCCGGCCGGCGTCGTCACCTTGACG
ACGGCCGCGCTGTTACAGCCCTCGGCCCGGCTCTGCGACATCTACGGCAGCCGGCTCGTCTTCTTGTTCGGCCAG
GCCTGGCTGATGGCCTGGTCCATCGTCACCGGCTTCAGCGTCAATACGTCCATGCTCATCGTCTGCCGCGCCATG
CAGGGCATCGGAGCCGCCGCCTTCCTGCCGGCCGGTCTCGCCCTGCTGGGCCATACCTACCGCCCGGGCCCGCGC
AAGAATGTGGCCTTTTCCATATACGGCGCCTTCGCCTGCGTCGGCTTCTACTTTGGCATCTTCATAGGCGCAGTC
TCGGCCGAGTTCCTTACCTGGCGCTGGTACTTTTGGATCGGCGCCATCATCTGCTTCATCAACCTGGCCTCTGGC
CTGCTGACGATCCCTCGTCGTCTCCCGGACGTGGATCCGGACGCCCGCATGGACTGGCTGGGCGTCATCACCATC
GTCCCGGGTCTCGTCCTCGTTGTCTTCGCCTTTACGGATGCCGGCGAGGTTCCCGGCGGCTGGCGCAACCCCCTG
ATTTACGCCACCTTTATCGTGGGCGTCATCTTCCTCGCCGTGGCCGTCTACGTCCAGGGCTGGGTCTCGGCTCAG
CCGCTGCTTTCCCCAGCGCTGTTCAAGCCCAGGTACATTAAGCGCCTGATGCTGTCGCTGTTTTGCTACTACGGC
GTCTTTGGAATCTTCCTTTTGTACACGAGCTTCTACATCGAAAACATTCTCCATATCAAACCGCTTCTGACGGCG
GCCTGGTACACGCCTCTCGCCGTCGGCGGCATGTTCTTGGCCATTGGCGGCGGCCTGGTTCTGCACATTGTGCCG
AACCGCATTCTCCTAACTATCTCGGGCCTCGGCTTCCTGCTATCGGTGCTCCTGTTCGCCCTGATACCGGGCCCG
GACGACGGCAAGTCCATCAGCTTCATCTACTGGGCCTACGTCTTCTCGGCCATGCTGGGGGGCACCATCGGCATC
GACATCACCTTCAACGTGACCAACGTCTTCATCACGACGGCCATGCCGCGCCGTCTCCAGGCCGCCGCCAGTGGG
CTCATCAACAGCCTACTGTACCTGGGCGTCGCCTTTTGGCTGGGTGTCGCCCAGACGGCCATTTCGGCGACGGAG
GAGAGGCGCGACGGCGGACTGGATGCGGCAGCCCAGTACCGGATCGCGTTCTGGACGGGCGTGGCGCTGGCAGGC
GTGGCGCTGTGTCTGACGCTGACGATCAAGATTGGCCAGGCCGAGGCGGACATGACGGCCGACGAGAAGGCCGAG
CAGGAGCGCGAGCCCATGGAGGCGGACGACCGGAGGACGACGGAGCAGACTGTGCCGACGTGA
Gene >Ophio5|5189
ATGCGGGTAGGTAGGAAGGGGGTAGGTAGAGGCGGCAAGAGCACCTTCCAACTAGAGCTTATCAGATCCATTTTT
CAAATCGGATGCAGATACACAACACAACACCGACGCCTGTTTCACCTTTTGGCCGCTCATCCAGCCTCACCAGCT
TCGGCATCGTGAGCCGCCTCAGAATCTGCACCCGCTAAGCCTAAAGCAGACTATTTCCGCGGCCTGCCGACAGAG
ACGTCGGAGCGCCGAGAGCGGACCAGGTAAGAAGTCATACATACCTACCTACTACACACACACACATACATACAT
ACATACATACAATTTTGGGCGGAATCTCTCCGTTTCAGGTTTCCGTTTTTTCCTTCTTCTCACCAGCTTTTGCCT
GTTTCAGCCGCGACAATAAACCGGGTCCCCGGACCTCTCCCCCGGCTTTGGTCCGCTCGGGGTCCGCGGACCGCG
TTCCGGACCCGGACCCCGACCCCGACGAGGCGAGGTTCGCCTCTCCAAACAGGCATCAGTTTTTTTCTGTCCTCC
TCATTCCACCCGACCGTGGTTCCGCCAGTTCGTTCAGGCTCCAATTCTGTCACATAGCTCGTGCACGTGCGTAAA
ATGCCCGTCGTACCAGTACAAAAAGCCAGCCACGACCACGACCACGACCAGGTGGCCTCGTTGGCTTCTCGATGT
TTGATGGACAACGACTCAACATGATGAAGAACTTGTCGCCCATCAAGCGGCTCAATCGGGCCGCCGTCGACGAGC
CCTCGTCGTCTAGCGTTGGTCAGCCCAACCATGGCGAATCCACTTCGTCTGGCGACGACAGCGACGGCGTCTTGG
TGACGGATGTCAAGCTTCTGGGCCGGGTCCGTCCCTCTGTCTTCTCCGGTCCTCTCGCCGAAGCAGCCTTCGTTC
TCACCGTCGTTCTCTCCATGATGACGAGCGAGTACTTTGTTGGCGGCTTCGACGTCATTCTGCCCACCATCGCCG
ACGCTCTCGCTATTCCGCCTAGTGCCCGCACCTGGCCGGCCGGCGTCGTCACCTTGACGACGGCCGCGCTGTTAC
AGCCCTCGGCCCGGCTCTGCGACATCTACGGCAGCCGGCTCGTCTTCTTGTTCGGCCAGGCCTGGCTGATGGCCT
GGTCCATCGTCACCGGCTTCAGCGTCAATACGTCCATGCTCATCGTCTGCCGCGCCATGCAGGGCATCGGAGCCG
CCGCCTTCCTGCCGGCCGGTCTCGCCCTGCTGGGCCATACCTACCGCCCGGGCCCGCGCAAGAATGTGGCCTTTT
CCATATACGGCGCCTTCGCCTGCGTCGGCTTCTACTTTGGCATCTTCATAGGCGCAGTCTCGGCCGAGTTCCTTA
CCTGGCGCTGGTACTTTTGGATCGGCGCCATCATCTGCTTCATCAACCTGGCCTCTGGCCTGCTGACGATCCCTC
GTCGTCTCCCGGACGTGGATCCGGACGCCCGCATGGACTGGCTGGGCGTCATCACCATCGTCCCGGGTCTCGTCC
TCGTTGTCTTCGCCTTTACGGATGCCGGCGAGGTTCCCGGCGGCTGGCGCAACCCCCTGATTTACGCCACCTTTA
TCGTGGGCGTCATCTTCCTCGCCGTGGCCGTCTACGTCCAGGGCTGGGTCTCGGCTCAGCCGCTGCTTTCCCCAG
CGCTGTTCAAGCCCAGGTACATTAAGCGCCTGATGCTGTCGCTGTTTTGCTACTACGGCGTCTTTGGAATCTTCC
TTTTGTACACGAGCTTCTAGTATGTCGGGCCCCGAGTGAGGAGGTGTTTTGTTTTTGGTGAGGGACGCTGACGTG
GCGATTGAAGCATCGAAAACATTCTCCATATCAAACCGCTTCTGACGGCGGCCTGGTACACGCCTCTCGCCGTCG
GCGGCATGTTCTTGGCCATTGGCGGCGGCCTGGTTCTGCACATTGTGCCGAACCGCATTCTCCTAACTATCTCGG
GCCTCGGCTTCCTGCTATCGGTGCTCCTGTTCGCCCTGATACCGGGCCCGGACGACGGCAAGTCCATCAGCTTCA
TCTACTGGGCCTACGTCTTCTCGGCCATGCTGGGGGGCACCATCGGCATCGACATCACCTTCAACGTGACCAACG
TCTTCATCACGACGGCCATGCCGCGCCGTCTCCAGGCCGCCGCCAGTGGGCTCATCAACAGCCTACTGTACCTGG
GCGTCGCCTTTTGGCTGGGTGTCGCCCAGACGGCCATTTCGGCGACGGAGGAGAGGCGCGACGGCGGACTGGATG
CGGCAGCCCAGTACCGGATCGCGTTCTGGACGGGCGTGGCGCTGGCAGGCGTGGCGCTGTGTCTGACGCTGACGA
TCAAGATTGGCCAGGCCGAGGCGGACATGACGGCCGACGAGAAGGCCGAGCAGGAGCGCGAGCCCATGGAGGCGG
ACGACCGGAGGACGACGGAGCAGACTGTGCCGACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail