Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5176
Gene name
Locationscaffold_417:15262..16380
Strand+
Gene length (bp)1118
Transcript length (bp)1053
Coding sequence length (bp)1050
Protein length (aa) 350

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 1.9E-07 226 284

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 189 341 2.0E-20
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 189 341 2.0E-20
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 74 341 1.0E-18
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 114 341 1.0E-14
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 193 341 7.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 189 341 2.0E-20
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 189 341 2.0E-20
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 74 341 1.0E-18
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 114 341 1.0E-14
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 193 341 7.0E-14
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 226 332 1.0E-13
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 210 341 1.0E-12
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 210 341 3.0E-12
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 226 341 4.0E-12
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 226 341 5.0E-12
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 227 341 6.0E-11
sp|Q3UNZ8|QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 226 336 1.0E-10
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 78 340 2.0E-10
sp|B0BNC9|QORL2_RAT Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1 226 336 3.0E-10
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 222 341 3.0E-10
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 227 341 4.0E-10
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 226 340 5.0E-10
sp|O35017|YOGA_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 212 336 5.0E-10
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 224 341 6.0E-10
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 228 341 6.0E-10
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 72 333 8.0E-10
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 221 313 1.0E-09
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 221 313 1.0E-09
sp|A6QQF5|QORL2_BOVIN Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2 227 326 2.0E-09
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 226 332 2.0E-09
sp|P42865|QOR_LEIAM Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 228 340 3.0E-09
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 221 341 4.0E-09
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 221 341 5.0E-09
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 226 332 5.0E-09
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 222 341 6.0E-09
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 222 341 6.0E-09
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 222 341 9.0E-09
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 224 341 1.0E-08
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 222 341 2.0E-08
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 129 341 3.0E-08
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 226 332 4.0E-08
sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 227 336 4.0E-08
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 228 343 7.0E-08
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 222 345 9.0E-08
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 226 332 1.0E-07
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 222 341 1.0E-07
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 227 341 1.0E-07
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 225 330 2.0E-07
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 211 311 2.0E-07
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 226 332 3.0E-07
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 226 341 6.0E-07
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 228 343 7.0E-07
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 196 341 7.0E-07
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 226 330 8.0E-07
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 228 332 1.0E-06
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 227 341 1.0E-06
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 238 341 2.0E-06
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 226 330 2.0E-06
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 228 333 2.0E-06
sp|K4BW79|ENOX_SOLLC 2-methylene-furan-3-one reductase OS=Solanum lycopersicum GN=EO PE=1 SV=1 226 330 6.0E-06
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 223 341 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5176
MVATAKEEAASHAGKVTLWYNTTRHDFAHLLASRFEAQRVQVQWCSIRDSHQVPDQDATHISTLDLDGPYFHNLS
SADYQAFIRHLSSFRAGSGLLWLTRLAQVECTDAHYGLILGLARTIRCELSLTFATVELQKLDTITAEAVFSIWS
RFSNPSLHVSDHLDPESEYVVYDGLVHVGRYHWFSAADELDAAPADKDALRLSCGRQRLVDSLSWTRLELAEPSA
DEVEVEIHCVGLNFRDILLSMAITEAKANENPGLEAAGVVSRVGSGINHVKVGDRVMIMGPSCFATRKLVPAELV
IALPPDLSFEEAATMPVAYGTAIHAIMTVGRLEKGQVSSVHHTWSPNSES
Coding >Ophio5|5176
ATGGTAGCCACGGCCAAGGAGGAGGCGGCCTCCCACGCTGGCAAAGTCACCTTGTGGTACAACACAACCAGACAC
GACTTCGCCCATCTTCTTGCCAGTCGTTTCGAGGCGCAGCGTGTCCAGGTTCAGTGGTGCTCGATCCGTGATTCG
CACCAGGTGCCGGATCAGGACGCTACACACATTTCCACTCTTGACCTCGACGGCCCCTATTTCCACAATCTATCT
TCGGCCGACTACCAAGCATTCATCCGCCATCTCTCCAGCTTCAGGGCCGGAAGTGGCCTTCTCTGGCTCACCCGG
CTAGCTCAAGTGGAATGCACAGATGCTCACTACGGACTCATCCTCGGACTAGCCCGCACCATCCGATGCGAGCTC
TCGCTGACCTTTGCCACGGTCGAGCTCCAAAAGCTAGACACCATCACCGCCGAAGCCGTCTTCTCCATCTGGTCC
CGTTTTTCCAATCCGTCTCTTCACGTCTCGGACCACTTGGACCCCGAGTCGGAATACGTCGTCTATGACGGCCTC
GTTCATGTTGGTCGCTATCATTGGTTTTCGGCGGCTGACGAGCTTGACGCTGCTCCTGCTGATAAGGATGCGCTG
CGGTTGAGCTGTGGACGGCAGAGACTCGTCGACTCACTGTCCTGGACGCGGCTTGAGTTGGCGGAACCGAGCGCG
GACGAGGTAGAGGTAGAGATTCATTGCGTGGGCTTGAATTTCCGGGATATTCTACTCTCCATGGCCATCACCGAA
GCCAAAGCCAACGAGAATCCCGGCTTAGAGGCGGCCGGAGTGGTTTCCCGCGTGGGGTCGGGCATCAACCACGTC
AAGGTGGGCGACCGCGTCATGATTATGGGCCCTAGTTGCTTCGCAACCCGGAAGCTGGTTCCTGCTGAGCTCGTC
ATCGCCCTCCCTCCCGACTTGAGTTTTGAAGAGGCGGCCACGATGCCTGTCGCCTACGGTACCGCCATTCACGCC
ATTATGACGGTGGGAAGGCTTGAAAAGGGCCAGGTCAGTTCCGTACACCACACATGGTCTCCAAACTCTGAAAGC
Transcript >Ophio5|5176
ATGGTAGCCACGGCCAAGGAGGAGGCGGCCTCCCACGCTGGCAAAGTCACCTTGTGGTACAACACAACCAGACAC
GACTTCGCCCATCTTCTTGCCAGTCGTTTCGAGGCGCAGCGTGTCCAGGTTCAGTGGTGCTCGATCCGTGATTCG
CACCAGGTGCCGGATCAGGACGCTACACACATTTCCACTCTTGACCTCGACGGCCCCTATTTCCACAATCTATCT
TCGGCCGACTACCAAGCATTCATCCGCCATCTCTCCAGCTTCAGGGCCGGAAGTGGCCTTCTCTGGCTCACCCGG
CTAGCTCAAGTGGAATGCACAGATGCTCACTACGGACTCATCCTCGGACTAGCCCGCACCATCCGATGCGAGCTC
TCGCTGACCTTTGCCACGGTCGAGCTCCAAAAGCTAGACACCATCACCGCCGAAGCCGTCTTCTCCATCTGGTCC
CGTTTTTCCAATCCGTCTCTTCACGTCTCGGACCACTTGGACCCCGAGTCGGAATACGTCGTCTATGACGGCCTC
GTTCATGTTGGTCGCTATCATTGGTTTTCGGCGGCTGACGAGCTTGACGCTGCTCCTGCTGATAAGGATGCGCTG
CGGTTGAGCTGTGGACGGCAGAGACTCGTCGACTCACTGTCCTGGACGCGGCTTGAGTTGGCGGAACCGAGCGCG
GACGAGGTAGAGGTAGAGATTCATTGCGTGGGCTTGAATTTCCGGGATATTCTACTCTCCATGGCCATCACCGAA
GCCAAAGCCAACGAGAATCCCGGCTTAGAGGCGGCCGGAGTGGTTTCCCGCGTGGGGTCGGGCATCAACCACGTC
AAGGTGGGCGACCGCGTCATGATTATGGGCCCTAGTTGCTTCGCAACCCGGAAGCTGGTTCCTGCTGAGCTCGTC
ATCGCCCTCCCTCCCGACTTGAGTTTTGAAGAGGCGGCCACGATGCCTGTCGCCTACGGTACCGCCATTCACGCC
ATTATGACGGTGGGAAGGCTTGAAAAGGGCCAGGTCAGTTCCGTACACCACACATGGTCTCCAAACTCTGAAAGC
TGA
Gene >Ophio5|5176
ATGGTAGCCACGGCCAAGGAGGAGGCGGCCTCCCACGCTGGCAAAGTCACCTTGTGGTACAACACAACCAGACAC
GACTTCGCCCATCTTCTTGCCAGTCGTTTCGAGGCGCAGCGTGTCCAGGTTCAGTGGTGCTCGATCCGTGATTCG
CACCAGGTGCCGGATCAGGACGCTACACACATTTCCACTCTTGACCTCGACGGCCCCTATTTCCACAATCTATCT
TCGGCCGACTACCAAGCATTCATCCGCCATCTCTCCAGCTTCAGGGCCGGAAGTGGCCTTCTCTGGCTCACCCGG
CTAGCTCAAGTGGAATGCACAGATGCTCACTACGGACTCATCCTCGGACTAGCCCGCACCATCCGATGCGAGCTC
TCGCTGACCTTTGCCACGGTCGAGCTCCAAAAGCTAGACACCATCACCGCCGAAGCCGTCTTCTCCATCTGGTCC
CGTTTTTCCAATCCGTCTCTTCACGTCTCGGACCACTTGGACCCCGAGTCGGAATACGTCGTCTATGACGGCCTC
GTTCATGTTGGTCGCTATCATTGGTTTTCGGCGGCTGACGAGCTTGACGCTGCTCCTGCTGATAAGGATGCGCTG
CGGTTGAGCTGTGGACGGCAGAGACTCGTCGACTCACTGTCCTGGACGCGGCTTGAGTTGGCGGAACCGAGCGCG
GACGAGGTAGAGGTAGAGATTCATTGCGTGGGCTTGAATTTCCGGGTAAGAGTCGAATTTCTTATGCTTCACCAC
AAGACACATCTCTGATACGAGTTCTCTCGGAACAGGATATTCTACTCTCCATGGCCATCACCGAAGCCAAAGCCA
ACGAGAATCCCGGCTTAGAGGCGGCCGGAGTGGTTTCCCGCGTGGGGTCGGGCATCAACCACGTCAAGGTGGGCG
ACCGCGTCATGATTATGGGCCCTAGTTGCTTCGCAACCCGGAAGCTGGTTCCTGCTGAGCTCGTCATCGCCCTCC
CTCCCGACTTGAGTTTTGAAGAGGCGGCCACGATGCCTGTCGCCTACGGTACCGCCATTCACGCCATTATGACGG
TGGGAAGGCTTGAAAAGGGCCAGGTCAGTTCCGTACACCACACATGGTCTCCAAACTCTGAAAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail