Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5173
Gene name
Locationscaffold_417:3940..5926
Strand-
Gene length (bp)1986
Transcript length (bp)1986
Coding sequence length (bp)1983
Protein length (aa) 661

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07732 Cu-oxidase_3 Multicopper oxidase 2.1E-39 112 226
PF07731 Cu-oxidase_2 Multicopper oxidase 9.4E-33 476 617
PF00394 Cu-oxidase Multicopper oxidase 2.0E-26 235 377

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CII3|FET3_KLULA Iron transport multicopper oxidase FET3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FET3 PE=3 SV=1 95 645 3.0E-63
sp|Q96WM9|LAC2_BOTFU Laccase-2 OS=Botryotinia fuckeliana GN=lcc2 PE=2 SV=1 88 615 2.0E-61
sp|P78591|FET3_CANAX Iron transport multicopper oxidase FET3 OS=Candida albicans GN=FET3 PE=3 SV=1 117 639 2.0E-61
sp|Q09920|FIO1_SCHPO Iron transport multicopper oxidase fio1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fio1 PE=3 SV=1 105 651 3.0E-60
sp|P38993|FET3_YEAST Iron transport multicopper oxidase FET3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET3 PE=1 SV=2 107 605 6.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CII3|FET3_KLULA Iron transport multicopper oxidase FET3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FET3 PE=3 SV=1 95 645 3.0E-63
sp|Q96WM9|LAC2_BOTFU Laccase-2 OS=Botryotinia fuckeliana GN=lcc2 PE=2 SV=1 88 615 2.0E-61
sp|P78591|FET3_CANAX Iron transport multicopper oxidase FET3 OS=Candida albicans GN=FET3 PE=3 SV=1 117 639 2.0E-61
sp|Q09920|FIO1_SCHPO Iron transport multicopper oxidase fio1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fio1 PE=3 SV=1 105 651 3.0E-60
sp|P38993|FET3_YEAST Iron transport multicopper oxidase FET3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET3 PE=1 SV=2 107 605 6.0E-60
sp|P43561|FET5_YEAST Iron transport multicopper oxidase FET5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET5 PE=1 SV=1 105 634 5.0E-58
sp|Q12570|LAC1_BOTFU Laccase-1 OS=Botryotinia fuckeliana GN=lcc1 PE=2 SV=3 111 615 6.0E-58
sp|Q96WT3|FET3_CANGA Iron transport multicopper oxidase FET3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FET3 PE=3 SV=1 107 644 8.0E-58
sp|Q02081|LAC4_THACU Laccase-4 OS=Thanatephorus cucumeris GN=LCC4 PE=1 SV=1 104 601 3.0E-57
sp|Q12542|LAC2_AGABI Laccase-2 OS=Agaricus bisporus GN=lcc2 PE=1 SV=1 105 634 8.0E-56
sp|Q12541|LAC1_AGABI Laccase-1 OS=Agaricus bisporus GN=lcc1 PE=1 SV=1 105 634 5.0E-54
sp|Q12717|LAC5_TRAVE Laccase-5 OS=Trametes versicolor GN=LCC5 PE=2 SV=1 110 634 1.0E-52
sp|Q99056|LAC5_TRAVI Laccase-5 OS=Trametes villosa GN=LCC5 PE=3 SV=2 110 634 2.0E-52
sp|D4APX3|LAC1_ARTBC Laccase ARB_05828 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05828 PE=1 SV=1 50 619 4.0E-52
sp|Q12718|LAC2_TRAVE Laccase-2 OS=Trametes versicolor GN=LCC2 PE=1 SV=1 111 640 4.0E-49
sp|Q01679|LAC1_PHLRA Laccase OS=Phlebia radiata GN=LAC PE=1 SV=2 104 612 7.0E-49
sp|Q99046|LAC2_TRAVI Laccase-2 OS=Trametes villosa GN=LCC2 PE=3 SV=1 111 640 8.0E-49
sp|P14133|ASO_CUCSA L-ascorbate oxidase OS=Cucumis sativus PE=1 SV=1 102 640 3.0E-48
sp|Q02079|LAC3_THACU Laccase-3 OS=Thanatephorus cucumeris GN=LCC3 PE=2 SV=1 106 643 7.0E-48
sp|P78722|LAC2_PODAS Laccase-2 OS=Podospora anserina GN=LAC2 PE=2 SV=1 103 619 1.0E-47
sp|Q40588|ASO_TOBAC L-ascorbate oxidase OS=Nicotiana tabacum GN=AAO PE=2 SV=1 105 638 2.0E-47
sp|Q03966|LAC1_CRYPA Laccase OS=Cryphonectria parasitica GN=LAC-1 PE=3 SV=1 103 617 2.0E-47
sp|P06811|LAC1_NEUCR Laccase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lacc PE=1 SV=3 110 618 3.0E-47
sp|D0VWU3|LAC1_TRAMX Laccase OS=Trametes maxima PE=1 SV=1 110 634 3.0E-46
sp|P56193|LAC1_THACU Laccase-1 OS=Thanatephorus cucumeris GN=LCC1 PE=1 SV=1 106 636 5.0E-46
sp|P37064|ASO_CUCPM L-ascorbate oxidase OS=Cucurbita pepo var. melopepo PE=1 SV=1 104 648 9.0E-46
sp|Q12729|LAC1_PLEOS Laccase-1 OS=Pleurotus ostreatus GN=POX1 PE=2 SV=1 111 634 1.0E-45
sp|P24792|ASO_CUCMA L-ascorbate oxidase OS=Cucurbita maxima GN=AAO PE=1 SV=2 104 648 1.0E-45
sp|Q12739|LAC2_PLEOS Laccase-2 OS=Pleurotus ostreatus GN=POX2 PE=1 SV=1 111 634 1.0E-45
sp|Q12719|LAC4_TRAVE Laccase-4 OS=Trametes versicolor GN=LCC4 PE=3 SV=1 110 634 3.0E-45
sp|Q99055|LAC4_TRAVI Laccase-4 OS=Trametes villosa GN=LCC4 PE=3 SV=1 110 634 5.0E-45
sp|O59896|LAC1_PYCCI Laccase OS=Pycnoporus cinnabarinus GN=LCC3-1 PE=1 SV=1 110 614 2.0E-44
sp|Q70KY3|LAC1_MELAO Laccase-1 OS=Melanocarpus albomyces GN=LAC1 PE=1 SV=1 107 623 2.0E-42
sp|Q02075|LAC2_THACU Laccase-2 OS=Thanatephorus cucumeris GN=LCC2 PE=2 SV=1 104 371 1.0E-41
sp|Q02497|LAC1_TRAHI Laccase OS=Trametes hirsuta PE=1 SV=1 110 634 2.0E-41
sp|Q99049|LAC3_TRAVI Laccase-3 OS=Trametes villosa GN=LCC3 PE=3 SV=1 111 612 4.0E-38
sp|Q99044|LAC1_TRAVI Laccase-1 OS=Trametes villosa GN=LCC1 PE=3 SV=1 110 372 1.0E-36
sp|Q2QUN2|LAC24_ORYSJ Laccase-24 OS=Oryza sativa subsp. japonica GN=LAC24 PE=2 SV=1 128 612 1.0E-36
sp|Q9ZPY2|LAC6_ARATH Laccase-6 OS=Arabidopsis thaliana GN=LAC6 PE=2 SV=1 125 617 6.0E-36
sp|O80434|LAC4_ARATH Laccase-4 OS=Arabidopsis thaliana GN=IRX12 PE=2 SV=2 94 633 4.0E-34
sp|Q0JHP8|LAC8_ORYSJ Laccase-8 OS=Oryza sativa subsp. japonica GN=LAC8 PE=3 SV=2 129 612 9.0E-34
sp|Q8RYM9|LAC2_ORYSJ Laccase-2 OS=Oryza sativa subsp. japonica GN=LAC2 PE=2 SV=1 123 617 1.0E-33
sp|Q2R0L0|LAC20_ORYSJ Laccase-20 OS=Oryza sativa subsp. japonica GN=LAC20 PE=2 SV=1 125 617 3.0E-33
sp|Q0DHL2|LAC12_ORYSJ Laccase-12/13 OS=Oryza sativa subsp. japonica GN=LAC12 PE=2 SV=1 103 615 3.0E-33
sp|Q5N9X2|LAC4_ORYSJ Laccase-4 OS=Oryza sativa subsp. japonica GN=LAC4 PE=2 SV=1 103 633 4.0E-33
sp|A2Y9C2|LAC20_ORYSI Laccase-20 OS=Oryza sativa subsp. indica GN=LAC20 PE=3 SV=1 125 617 1.0E-32
sp|Q69L99|LAC14_ORYSJ Laccase-14 OS=Oryza sativa subsp. japonica GN=LAC14 PE=3 SV=1 104 612 2.0E-32
sp|Q9SIY8|LAC5_ARATH Laccase-5 OS=Arabidopsis thaliana GN=LAC5 PE=2 SV=1 126 617 4.0E-32
sp|Q8VZA1|LAC11_ARATH Laccase-11 OS=Arabidopsis thaliana GN=LAC11 PE=2 SV=1 123 632 2.0E-31
sp|Q2R0L2|LAC19_ORYSJ Laccase-19 OS=Oryza sativa subsp. japonica GN=LAC19 PE=2 SV=1 125 640 5.0E-31
sp|O81081|LAC2_ARATH Laccase-2 OS=Arabidopsis thaliana GN=LAC2 PE=2 SV=1 86 612 7.0E-31
sp|Q6ID18|LAC10_ARATH Laccase-10 OS=Arabidopsis thaliana GN=LAC10 PE=2 SV=1 104 617 7.0E-31
sp|Q1PDH6|LAC16_ARATH Laccase-16 OS=Arabidopsis thaliana GN=LAC16 PE=2 SV=2 123 615 7.0E-31
sp|Q04399|GMC1_YEAST Putative multicopper oxidase GMC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GMC1 PE=1 SV=1 156 610 1.0E-30
sp|Q9SR40|LAC7_ARATH Laccase-7 OS=Arabidopsis thaliana GN=LAC7 PE=2 SV=1 125 617 2.0E-29
sp|Q6Z8L2|LAC9_ORYSJ Putative laccase-9 OS=Oryza sativa subsp. japonica GN=LAC9 PE=3 SV=1 123 629 3.0E-29
sp|Q0IQU1|LAC22_ORYSJ Laccase-22 OS=Oryza sativa subsp. japonica GN=LAC22 PE=2 SV=2 103 633 5.0E-29
sp|Q9SU40|SKU5_ARATH Monocopper oxidase-like protein SKU5 OS=Arabidopsis thaliana GN=SKU5 PE=1 SV=1 107 605 4.0E-28
sp|Q5ZCW1|LAC1_ORYSJ Putative laccase-1 OS=Oryza sativa subsp. japonica GN=LAC1 PE=3 SV=1 123 629 3.0E-27
sp|Q2QZ80|LAC21_ORYSJ Laccase-21 OS=Oryza sativa subsp. japonica GN=LAC21 PE=2 SV=1 123 629 7.0E-27
sp|Q96UM2|LAC3_BOTFU Laccase-3 (Fragment) OS=Botryotinia fuckeliana GN=lcc3 PE=3 SV=1 133 373 2.0E-26
sp|P29162|ASOL_TOBAC L-ascorbate oxidase homolog OS=Nicotiana tabacum PE=2 SV=1 107 598 3.0E-26
sp|Q9FY79|LAC14_ARATH Laccase-14 OS=Arabidopsis thaliana GN=LAC14 PE=2 SV=1 125 617 9.0E-26
sp|P59571|COPA_PSESM Copper resistance protein A homolog OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=copA PE=3 SV=1 106 358 6.0E-24
sp|Q9LMS3|LAC1_ARATH Laccase-1 OS=Arabidopsis thaliana GN=LAC1 PE=2 SV=1 97 382 1.0E-23
sp|P12374|COPA_PSEUB Copper resistance protein A OS=Pseudomonas syringae pv. tomato GN=copA PE=1 SV=1 93 367 2.0E-23
sp|I6WZK7|MMCO_MYCTU Multicopper oxidase MmcO OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmcO PE=1 SV=1 114 614 3.0E-23
sp|A2XCN6|LAC18_ORYSI Putative laccase-18 OS=Oryza sativa subsp. indica GN=LAC18 PE=3 SV=1 125 357 1.0E-22
sp|Q47452|PCOA_ECOLX Copper resistance protein A OS=Escherichia coli GN=pcoA PE=3 SV=1 106 358 2.0E-22
sp|Q53LU4|LAC18_ORYSJ Laccase-18 OS=Oryza sativa subsp. japonica GN=LAC18 PE=2 SV=1 125 360 1.0E-21
sp|Q339K6|LAC15_ORYSJ Laccase-15 OS=Oryza sativa subsp. japonica GN=LAC15 PE=2 SV=1 110 372 2.0E-21
sp|A2Y9C5|LAC19_ORYSI Putative laccase-19 OS=Oryza sativa subsp. indica GN=LAC19 PE=3 SV=1 125 357 5.0E-21
sp|Q9FHN6|SKS2_ARATH Monocopper oxidase-like protein SKS2 OS=Arabidopsis thaliana GN=SKS2 PE=1 SV=1 106 371 2.0E-20
sp|Q9FJD5|LAC17_ARATH Laccase-17 OS=Arabidopsis thaliana GN=LAC17 PE=2 SV=1 123 372 2.0E-20
sp|Q7XE50|LAC16_ORYSJ Putative laccase-16 OS=Oryza sativa subsp. japonica GN=LAC16 PE=5 SV=1 143 629 5.0E-20
sp|Q9FLB5|LAC12_ARATH Laccase-12 OS=Arabidopsis thaliana GN=LAC12 PE=2 SV=1 123 357 3.0E-19
sp|Q5N7B4|LAC7_ORYSJ Laccase-7 OS=Oryza sativa subsp. japonica GN=LAC7 PE=2 SV=1 125 372 4.0E-19
sp|Q00624|ASOL_BRANA L-ascorbate oxidase homolog OS=Brassica napus GN=Bp10 PE=2 SV=1 107 381 5.0E-19
sp|Q56YT0|LAC3_ARATH Laccase-3 OS=Arabidopsis thaliana GN=LAC3 PE=2 SV=2 126 360 6.0E-19
sp|Q0IP28|LAC25_ORYSJ Laccase-25 OS=Oryza sativa subsp. japonica GN=LAC25 PE=3 SV=1 124 357 7.0E-19
sp|Q5N7A3|LAC6_ORYSJ Laccase-6 OS=Oryza sativa subsp. japonica GN=LAC6 PE=2 SV=1 128 362 2.0E-18
sp|Q9LFD1|LAC9_ARATH Laccase-9 OS=Arabidopsis thaliana GN=LAC9 PE=2 SV=1 111 351 4.0E-18
sp|Q941X2|LAC3_ORYSJ Laccase-3 OS=Oryza sativa subsp. japonica GN=LAC3 PE=2 SV=1 125 372 6.0E-18
sp|Q2RBK2|LAC17_ORYSJ Putative laccase-17 OS=Oryza sativa subsp. japonica GN=LAC17 PE=3 SV=1 125 357 9.0E-18
sp|P17489|LAC1_EMENI Laccase-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yA PE=2 SV=3 120 365 1.0E-17
sp|Q10ND7|LAC10_ORYSJ Laccase-10 OS=Oryza sativa subsp. japonica GN=LAC10 PE=2 SV=1 123 409 1.0E-17
sp|Q5N9W4|LAC5_ORYSJ Putative laccase-5 OS=Oryza sativa subsp. japonica GN=LAC5 PE=3 SV=1 103 359 2.0E-17
sp|Q8VXX5|SKS1_ARATH Monocopper oxidase-like protein SKS1 OS=Arabidopsis thaliana GN=SKS1 PE=1 SV=1 117 371 5.0E-17
sp|Q9LFD2|LAC8_ARATH Laccase-8 OS=Arabidopsis thaliana GN=LAC8 PE=2 SV=1 129 403 2.0E-16
sp|Q2QYS3|LAC23_ORYSJ Laccase-23 OS=Oryza sativa subsp. japonica GN=LAC23 PE=3 SV=1 123 357 2.0E-16
sp|Q9LYQ2|LAC13_ARATH Laccase-13 OS=Arabidopsis thaliana GN=LAC13 PE=2 SV=1 126 382 3.0E-16
sp|Q84J37|LAC15_ARATH Laccase-15 OS=Arabidopsis thaliana GN=TT10 PE=1 SV=1 123 372 5.0E-16
sp|Q0DHL5|LAC11_ORYSJ Putative laccase-11 OS=Oryza sativa subsp. japonica GN=LAC11 PE=5 SV=2 128 357 7.0E-16
sp|Q9LFD1|LAC9_ARATH Laccase-9 OS=Arabidopsis thaliana GN=LAC9 PE=2 SV=1 504 637 1.0E-12
sp|Q5N7A3|LAC6_ORYSJ Laccase-6 OS=Oryza sativa subsp. japonica GN=LAC6 PE=2 SV=1 492 612 2.0E-12
sp|Q10ND7|LAC10_ORYSJ Laccase-10 OS=Oryza sativa subsp. japonica GN=LAC10 PE=2 SV=1 504 633 2.0E-12
sp|Q5N9W4|LAC5_ORYSJ Putative laccase-5 OS=Oryza sativa subsp. japonica GN=LAC5 PE=3 SV=1 504 633 2.0E-12
sp|Q941X2|LAC3_ORYSJ Laccase-3 OS=Oryza sativa subsp. japonica GN=LAC3 PE=2 SV=1 502 617 1.0E-11
sp|A2XCN6|LAC18_ORYSI Putative laccase-18 OS=Oryza sativa subsp. indica GN=LAC18 PE=3 SV=1 480 617 2.0E-11
sp|Q53LU4|LAC18_ORYSJ Laccase-18 OS=Oryza sativa subsp. japonica GN=LAC18 PE=2 SV=1 480 617 2.0E-11
sp|Q0IP28|LAC25_ORYSJ Laccase-25 OS=Oryza sativa subsp. japonica GN=LAC25 PE=3 SV=1 504 614 2.0E-11
sp|Q2QYS3|LAC23_ORYSJ Laccase-23 OS=Oryza sativa subsp. japonica GN=LAC23 PE=3 SV=1 502 615 3.0E-11
sp|Q2RBK2|LAC17_ORYSJ Putative laccase-17 OS=Oryza sativa subsp. japonica GN=LAC17 PE=3 SV=1 502 615 4.0E-11
sp|Q9FJD5|LAC17_ARATH Laccase-17 OS=Arabidopsis thaliana GN=LAC17 PE=2 SV=1 504 616 5.0E-11
sp|Q0DHL5|LAC11_ORYSJ Putative laccase-11 OS=Oryza sativa subsp. japonica GN=LAC11 PE=5 SV=2 514 633 5.0E-11
sp|Q96UM2|LAC3_BOTFU Laccase-3 (Fragment) OS=Botryotinia fuckeliana GN=lcc3 PE=3 SV=1 532 614 7.0E-11
sp|Q9FLB5|LAC12_ARATH Laccase-12 OS=Arabidopsis thaliana GN=LAC12 PE=2 SV=1 504 633 9.0E-11
sp|Q339K6|LAC15_ORYSJ Laccase-15 OS=Oryza sativa subsp. japonica GN=LAC15 PE=2 SV=1 519 610 1.0E-10
sp|Q56YT0|LAC3_ARATH Laccase-3 OS=Arabidopsis thaliana GN=LAC3 PE=2 SV=2 489 615 1.0E-10
sp|Q9LYQ2|LAC13_ARATH Laccase-13 OS=Arabidopsis thaliana GN=LAC13 PE=2 SV=1 504 617 1.0E-10
sp|Q9LFD2|LAC8_ARATH Laccase-8 OS=Arabidopsis thaliana GN=LAC8 PE=2 SV=1 504 637 2.0E-10
sp|Q5N7B4|LAC7_ORYSJ Laccase-7 OS=Oryza sativa subsp. japonica GN=LAC7 PE=2 SV=1 504 612 3.0E-10
sp|A2Y9C5|LAC19_ORYSI Putative laccase-19 OS=Oryza sativa subsp. indica GN=LAC19 PE=3 SV=1 504 640 6.0E-10
sp|Q9LMS3|LAC1_ARATH Laccase-1 OS=Arabidopsis thaliana GN=LAC1 PE=2 SV=1 532 633 7.0E-10
sp|Q7N0E3|FTSP_PHOLL Cell division protein FtsP OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ftsP PE=3 SV=1 104 360 6.0E-08
sp|Q84J37|LAC15_ARATH Laccase-15 OS=Arabidopsis thaliana GN=TT10 PE=1 SV=1 532 617 2.0E-07
sp|Q02075|LAC2_THACU Laccase-2 OS=Thanatephorus cucumeris GN=LCC2 PE=2 SV=1 431 612 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005507 copper ion binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.5

Transmembrane Domains

Domain # Start End Length
1 33 55 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.24 0.00 0.59
CcL In ants, during behavior modification 2.44 0.51 4.36
CcD In ants, recently dead 1.25 0.12 2.39

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.007944 yes
SC16a CcD 1.000000 no
CcL CcD 0.113934 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5173
MLPPDDDGERPLLGAAASPPTPRRRRPPDTPRVMLFLTVAIVGTFLLFSIFLSLPSMMGPVRGEEDDGIVVHHDD
HVPASPRLRDASEYILDSSSWPRNSPPVIREFHWTIADAQLNPDGVFRPMILINNQFPGPLVECNEDDRLVIHVD
NRASTATAIHFHGLFQNGSNAMDGTVGVTQCPMAPNSSFTYRFHIRRQSGTYWYHAHQAVQASDGLVGPVVIHAK
DEVVDYDSDRILMVQDHYHNSSTDLVADYLVPGNENDEPVPDNGLINGRGLRSCRDFPGWRCDDGDVSRSVLDLA
AGARHRLRIINVGVFAQFQIQIDEHPFYLTEVDGTDVVPEPFHRLNILPAQRYSILIETNVTSADAFWLRARMVT
HCFTTTNPRLQPELWAVVRYLRPDSDSPPGQVEEPNSREWPEAIEVICRDLNTSALRPVKPMEAPPADDFLVLRA
NFKTGAWRLSHGFFNDSTWRLNASYPSLHRFLDAGPEAQSVTGPSALTVNDDIYDRKSELVVQTVGIRTVDISIN
SFDDGAHPFHLHGHKFFVLAQGNSGYPPTPDRWPAFLEAGLPSNPLRRDTVTVEPYAWVVIRVVLDNPGFWALHC
HNSWHAAAGMVMQLLARADVVSRWQLDPRQRDLCGRDGLTAGGVAESLRPIPGGRPLDGAG
Coding >Ophio5|5173
ATGCTCCCCCCCGACGACGACGGAGAGCGGCCGCTCCTCGGCGCCGCGGCCTCTCCACCGACCCCCCGCCGCCGT
CGTCCTCCGGATACGCCGAGAGTGATGCTCTTCCTGACCGTCGCCATTGTCGGCACTTTCCTCCTCTTCTCCATC
TTTCTCTCCCTCCCGTCTATGATGGGCCCCGTGAGGGGAGAGGAAGACGACGGCATCGTCGTTCACCATGACGAT
CATGTTCCAGCCTCTCCCCGACTGCGAGACGCGTCGGAATACATACTCGACTCATCCTCGTGGCCTCGGAACTCG
CCTCCGGTCATTCGCGAGTTTCACTGGACCATAGCCGACGCCCAACTCAACCCGGACGGCGTCTTCCGTCCCATG
ATCCTCATCAACAATCAGTTCCCCGGCCCGCTCGTCGAATGCAACGAGGACGACAGGCTGGTGATCCACGTCGAC
AACCGAGCATCCACCGCTACCGCCATCCATTTTCACGGCCTCTTTCAAAACGGCTCCAACGCCATGGACGGCACC
GTCGGCGTGACGCAGTGTCCGATGGCGCCCAACTCGTCTTTCACCTACCGCTTTCACATCCGTCGTCAGTCCGGA
ACCTACTGGTATCACGCCCATCAGGCCGTTCAGGCCTCGGACGGTCTCGTCGGTCCCGTCGTCATCCATGCCAAG
GACGAAGTCGTCGACTACGATTCGGATCGTATCCTCATGGTTCAGGATCACTATCACAACTCTTCTACCGACCTC
GTGGCAGACTATCTCGTTCCGGGCAACGAAAACGACGAACCGGTGCCGGATAACGGCCTCATCAACGGTCGAGGC
CTTCGTAGTTGTCGTGATTTTCCCGGCTGGCGCTGTGACGACGGCGACGTGTCGCGCTCCGTCTTGGACCTCGCC
GCCGGAGCCCGCCACCGGCTGCGCATCATCAACGTAGGCGTCTTCGCCCAGTTCCAGATACAGATCGACGAGCAT
CCCTTTTACCTGACAGAGGTCGACGGCACCGACGTCGTCCCCGAACCCTTCCATAGGCTCAACATACTGCCCGCT
CAGCGCTACAGCATCCTCATCGAGACAAACGTCACCTCAGCCGACGCCTTCTGGCTCCGCGCCAGGATGGTCACC
CACTGCTTCACCACCACGAACCCCCGTCTGCAGCCCGAGCTCTGGGCCGTCGTCCGCTACCTTCGGCCTGACTCC
GACTCGCCCCCCGGACAAGTCGAGGAGCCCAACAGCAGGGAGTGGCCCGAGGCCATCGAGGTCATCTGTCGCGAT
CTCAACACGTCCGCTCTCCGGCCCGTCAAGCCCATGGAAGCTCCTCCCGCCGACGACTTTCTCGTCCTACGCGCC
AACTTCAAGACCGGCGCCTGGCGTCTCTCCCACGGCTTCTTCAACGACTCGACCTGGCGTCTCAACGCCAGCTAC
CCGTCTTTGCACCGCTTCCTCGACGCCGGTCCGGAAGCCCAGTCGGTCACCGGCCCCTCGGCTCTGACCGTCAAC
GACGACATCTACGACCGCAAGTCGGAGCTCGTGGTGCAAACCGTCGGCATCCGCACCGTCGATATATCCATCAAC
TCCTTCGACGACGGCGCCCACCCCTTCCATCTTCACGGCCACAAGTTCTTCGTCCTCGCTCAGGGGAACAGCGGC
TATCCGCCCACTCCCGACCGCTGGCCGGCCTTTCTCGAAGCCGGCCTGCCGTCGAACCCGCTGCGGCGAGACACC
GTCACCGTCGAGCCCTACGCCTGGGTCGTCATCCGCGTCGTCCTCGATAACCCGGGCTTCTGGGCCCTGCATTGC
CATAACAGCTGGCACGCCGCCGCCGGCATGGTCATGCAGCTGCTGGCCCGCGCCGATGTCGTCAGCCGTTGGCAA
CTCGACCCTCGCCAGAGGGACTTGTGCGGCCGAGACGGCCTGACGGCAGGCGGCGTGGCCGAGAGCCTGAGACCG
ATCCCCGGAGGACGGCCGTTGGATGGCGCCGGT
Transcript >Ophio5|5173
ATGCTCCCCCCCGACGACGACGGAGAGCGGCCGCTCCTCGGCGCCGCGGCCTCTCCACCGACCCCCCGCCGCCGT
CGTCCTCCGGATACGCCGAGAGTGATGCTCTTCCTGACCGTCGCCATTGTCGGCACTTTCCTCCTCTTCTCCATC
TTTCTCTCCCTCCCGTCTATGATGGGCCCCGTGAGGGGAGAGGAAGACGACGGCATCGTCGTTCACCATGACGAT
CATGTTCCAGCCTCTCCCCGACTGCGAGACGCGTCGGAATACATACTCGACTCATCCTCGTGGCCTCGGAACTCG
CCTCCGGTCATTCGCGAGTTTCACTGGACCATAGCCGACGCCCAACTCAACCCGGACGGCGTCTTCCGTCCCATG
ATCCTCATCAACAATCAGTTCCCCGGCCCGCTCGTCGAATGCAACGAGGACGACAGGCTGGTGATCCACGTCGAC
AACCGAGCATCCACCGCTACCGCCATCCATTTTCACGGCCTCTTTCAAAACGGCTCCAACGCCATGGACGGCACC
GTCGGCGTGACGCAGTGTCCGATGGCGCCCAACTCGTCTTTCACCTACCGCTTTCACATCCGTCGTCAGTCCGGA
ACCTACTGGTATCACGCCCATCAGGCCGTTCAGGCCTCGGACGGTCTCGTCGGTCCCGTCGTCATCCATGCCAAG
GACGAAGTCGTCGACTACGATTCGGATCGTATCCTCATGGTTCAGGATCACTATCACAACTCTTCTACCGACCTC
GTGGCAGACTATCTCGTTCCGGGCAACGAAAACGACGAACCGGTGCCGGATAACGGCCTCATCAACGGTCGAGGC
CTTCGTAGTTGTCGTGATTTTCCCGGCTGGCGCTGTGACGACGGCGACGTGTCGCGCTCCGTCTTGGACCTCGCC
GCCGGAGCCCGCCACCGGCTGCGCATCATCAACGTAGGCGTCTTCGCCCAGTTCCAGATACAGATCGACGAGCAT
CCCTTTTACCTGACAGAGGTCGACGGCACCGACGTCGTCCCCGAACCCTTCCATAGGCTCAACATACTGCCCGCT
CAGCGCTACAGCATCCTCATCGAGACAAACGTCACCTCAGCCGACGCCTTCTGGCTCCGCGCCAGGATGGTCACC
CACTGCTTCACCACCACGAACCCCCGTCTGCAGCCCGAGCTCTGGGCCGTCGTCCGCTACCTTCGGCCTGACTCC
GACTCGCCCCCCGGACAAGTCGAGGAGCCCAACAGCAGGGAGTGGCCCGAGGCCATCGAGGTCATCTGTCGCGAT
CTCAACACGTCCGCTCTCCGGCCCGTCAAGCCCATGGAAGCTCCTCCCGCCGACGACTTTCTCGTCCTACGCGCC
AACTTCAAGACCGGCGCCTGGCGTCTCTCCCACGGCTTCTTCAACGACTCGACCTGGCGTCTCAACGCCAGCTAC
CCGTCTTTGCACCGCTTCCTCGACGCCGGTCCGGAAGCCCAGTCGGTCACCGGCCCCTCGGCTCTGACCGTCAAC
GACGACATCTACGACCGCAAGTCGGAGCTCGTGGTGCAAACCGTCGGCATCCGCACCGTCGATATATCCATCAAC
TCCTTCGACGACGGCGCCCACCCCTTCCATCTTCACGGCCACAAGTTCTTCGTCCTCGCTCAGGGGAACAGCGGC
TATCCGCCCACTCCCGACCGCTGGCCGGCCTTTCTCGAAGCCGGCCTGCCGTCGAACCCGCTGCGGCGAGACACC
GTCACCGTCGAGCCCTACGCCTGGGTCGTCATCCGCGTCGTCCTCGATAACCCGGGCTTCTGGGCCCTGCATTGC
CATAACAGCTGGCACGCCGCCGCCGGCATGGTCATGCAGCTGCTGGCCCGCGCCGATGTCGTCAGCCGTTGGCAA
CTCGACCCTCGCCAGAGGGACTTGTGCGGCCGAGACGGCCTGACGGCAGGCGGCGTGGCCGAGAGCCTGAGACCG
ATCCCCGGAGGACGGCCGTTGGATGGCGCCGGTTGA
Gene >Ophio5|5173
ATGCTCCCCCCCGACGACGACGGAGAGCGGCCGCTCCTCGGCGCCGCGGCCTCTCCACCGACCCCCCGCCGCCGT
CGTCCTCCGGATACGCCGAGAGTGATGCTCTTCCTGACCGTCGCCATTGTCGGCACTTTCCTCCTCTTCTCCATC
TTTCTCTCCCTCCCGTCTATGATGGGCCCCGTGAGGGGAGAGGAAGACGACGGCATCGTCGTTCACCATGACGAT
CATGTTCCAGCCTCTCCCCGACTGCGAGACGCGTCGGAATACATACTCGACTCATCCTCGTGGCCTCGGAACTCG
CCTCCGGTCATTCGCGAGTTTCACTGGACCATAGCCGACGCCCAACTCAACCCGGACGGCGTCTTCCGTCCCATG
ATCCTCATCAACAATCAGTTCCCCGGCCCGCTCGTCGAATGCAACGAGGACGACAGGCTGGTGATCCACGTCGAC
AACCGAGCATCCACCGCTACCGCCATCCATTTTCACGGCCTCTTTCAAAACGGCTCCAACGCCATGGACGGCACC
GTCGGCGTGACGCAGTGTCCGATGGCGCCCAACTCGTCTTTCACCTACCGCTTTCACATCCGTCGTCAGTCCGGA
ACCTACTGGTATCACGCCCATCAGGCCGTTCAGGCCTCGGACGGTCTCGTCGGTCCCGTCGTCATCCATGCCAAG
GACGAAGTCGTCGACTACGATTCGGATCGTATCCTCATGGTTCAGGATCACTATCACAACTCTTCTACCGACCTC
GTGGCAGACTATCTCGTTCCGGGCAACGAAAACGACGAACCGGTGCCGGATAACGGCCTCATCAACGGTCGAGGC
CTTCGTAGTTGTCGTGATTTTCCCGGCTGGCGCTGTGACGACGGCGACGTGTCGCGCTCCGTCTTGGACCTCGCC
GCCGGAGCCCGCCACCGGCTGCGCATCATCAACGTAGGCGTCTTCGCCCAGTTCCAGATACAGATCGACGAGCAT
CCCTTTTACCTGACAGAGGTCGACGGCACCGACGTCGTCCCCGAACCCTTCCATAGGCTCAACATACTGCCCGCT
CAGCGCTACAGCATCCTCATCGAGACAAACGTCACCTCAGCCGACGCCTTCTGGCTCCGCGCCAGGATGGTCACC
CACTGCTTCACCACCACGAACCCCCGTCTGCAGCCCGAGCTCTGGGCCGTCGTCCGCTACCTTCGGCCTGACTCC
GACTCGCCCCCCGGACAAGTCGAGGAGCCCAACAGCAGGGAGTGGCCCGAGGCCATCGAGGTCATCTGTCGCGAT
CTCAACACGTCCGCTCTCCGGCCCGTCAAGCCCATGGAAGCTCCTCCCGCCGACGACTTTCTCGTCCTACGCGCC
AACTTCAAGACCGGCGCCTGGCGTCTCTCCCACGGCTTCTTCAACGACTCGACCTGGCGTCTCAACGCCAGCTAC
CCGTCTTTGCACCGCTTCCTCGACGCCGGTCCGGAAGCCCAGTCGGTCACCGGCCCCTCGGCTCTGACCGTCAAC
GACGACATCTACGACCGCAAGTCGGAGCTCGTGGTGCAAACCGTCGGCATCCGCACCGTCGATATATCCATCAAC
TCCTTCGACGACGGCGCCCACCCCTTCCATCTTCACGGCCACAAGTTCTTCGTCCTCGCTCAGGGGAACAGCGGC
TATCCGCCCACTCCCGACCGCTGGCCGGCCTTTCTCGAAGCCGGCCTGCCGTCGAACCCGCTGCGGCGAGACACC
GTCACCGTCGAGCCCTACGCCTGGGTCGTCATCCGCGTCGTCCTCGATAACCCGGGCTTCTGGGCCCTGCATTGC
CATAACAGCTGGCACGCCGCCGCCGGCATGGTCATGCAGCTGCTGGCCCGCGCCGATGTCGTCAGCCGTTGGCAA
CTCGACCCTCGCCAGAGGGACTTGTGCGGCCGAGACGGCCTGACGGCAGGCGGCGTGGCCGAGAGCCTGAGACCG
ATCCCCGGAGGACGGCCGTTGGATGGCGCCGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail