Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5170
Gene name
Locationscaffold_416:15260..15848
Strand+
Gene length (bp)588
Transcript length (bp)411
Coding sequence length (bp)408
Protein length (aa) 136

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 63 82 19
2 113 135 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 67.07 26.92 107.22
CcL In ants, during behavior modification 37.32 11.93 62.71
CcD In ants, recently dead 35.49 11.70 59.28

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.054965 no
SC16a CcD 0.038757 yes
CcL CcD 0.905455 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5170
MFEPHPEEHYHLRLHRARSVVLTSDELVEIRASQRTYEGAYMRTALGQFSFALVVLKIFTREFYPIGALFAAYGL
AVLVVASYRRYQGHRQFFTAESPDGVVQRKFKTSGDTVVLMTALSLGAYATLLVLTWRLVA
Coding >Ophio5|5170
ATGTTCGAGCCTCATCCTGAGGAGCATTATCACCTGCGCCTCCATCGCGCCCGCTCCGTTGTCCTGACATCTGAC
GAACTTGTCGAGATACGCGCCTCCCAACGTACCTACGAGGGCGCCTACATGCGCACCGCCCTCGGCCAGTTCTCC
TTCGCCCTTGTTGTCCTCAAAATCTTCACCCGAGAGTTCTACCCCATCGGTGCCCTTTTCGCCGCTTACGGCCTT
GCCGTCCTCGTCGTCGCTTCCTACCGTCGCTACCAGGGCCATCGTCAGTTCTTCACCGCAGAGTCCCCGGACGGA
GTCGTGCAACGAAAGTTCAAGACCAGTGGCGACACCGTCGTTCTCATGACAGCTCTGAGCCTCGGCGCCTACGCC
ACCTTGCTAGTGCTGACTTGGCGCCTGGTTGCC
Transcript >Ophio5|5170
ATGTTCGAGCCTCATCCTGAGGAGCATTATCACCTGCGCCTCCATCGCGCCCGCTCCGTTGTCCTGACATCTGAC
GAACTTGTCGAGATACGCGCCTCCCAACGTACCTACGAGGGCGCCTACATGCGCACCGCCCTCGGCCAGTTCTCC
TTCGCCCTTGTTGTCCTCAAAATCTTCACCCGAGAGTTCTACCCCATCGGTGCCCTTTTCGCCGCTTACGGCCTT
GCCGTCCTCGTCGTCGCTTCCTACCGTCGCTACCAGGGCCATCGTCAGTTCTTCACCGCAGAGTCCCCGGACGGA
GTCGTGCAACGAAAGTTCAAGACCAGTGGCGACACCGTCGTTCTCATGACAGCTCTGAGCCTCGGCGCCTACGCC
ACCTTGCTAGTGCTGACTTGGCGCCTGGTTGCCTAG
Gene >Ophio5|5170
ATGTTCGAGGTCTTTTCACCCCCCCCCTCCGCCATCTCCCCCCAATATGTCGACCTCGTCAAGCTGACAACTGCC
CCCCCCCCTTCTTCGTCTTTCCCTAGCCTCATCCTGAGGAGCATTATCACCTGCGCCTCCATCGCGCCCGCTCCG
TTGTCCTGACATCTGACGAGTGCGTCTTGGATTTCCCGCCTCCGAACCCCGCATAACCTGCCTCTTGCCCTGACA
CGGCGCGTTTTGTTTCCCCCCCCCCAAAGACTTGTCGAGATACGCGCCTCCCAACGTACCTACGAGGGCGCCTAC
ATGCGCACCGCCCTCGGCCAGTTCTCCTTCGCCCTTGTTGTCCTCAAAATCTTCACCCGAGAGTTCTACCCCATC
GGTGCCCTTTTCGCCGCTTACGGCCTTGCCGTCCTCGTCGTCGCTTCCTACCGTCGCTACCAGGGCCATCGTCAG
TTCTTCACCGCAGAGTCCCCGGACGGAGTCGTGCAACGAAAGTTCAAGACCAGTGGCGACACCGTCGTTCTCATG
ACAGCTCTGAGCCTCGGCGCCTACGCCACCTTGCTAGTGCTGACTTGGCGCCTGGTTGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail