Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5164
Gene name
Locationscaffold_416:114..462
Strand+
Gene length (bp)348
Transcript length (bp)348
Coding sequence length (bp)345
Protein length (aa) 115

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6UEF1|AFLY_ASPPA Oxidoreductase AflY OS=Aspergillus parasiticus GN=aflY PE=4 SV=1 2 115 8.0E-06

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5179 0.5386 0.5229 0.0923 0.2678 0.064 0.1144 0.1425 0.1943 0.1046

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup405
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6941
Ophiocordyceps australis map64 (Brazil) OphauB2|5850
Ophiocordyceps camponoti-floridani Ophcf2|04830
Ophiocordyceps camponoti-rufipedis Ophun1|5854
Ophiocordyceps kimflemingae Ophio5|5164 (this protein)
Ophiocordyceps kimflemingae Ophio5|682
Ophiocordyceps subramaniannii Hirsu2|2221
Ophiocordyceps subramaniannii Hirsu2|2825

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5164
MRMDVIGYLARGCPALRLDDTLQPPSEARQARHLVSRFHDIVDDGHLIKVVRSLLLAQEASIMWEAKPWIRLKTE
SDWLRAMNRLLVGSEGAKSNQIWVRSAGFPQAWKGYPRME
Coding >Ophio5|5164
ATGCGCATGGACGTCATCGGCTACCTAGCCCGAGGCTGTCCGGCTCTACGGCTCGACGATACGCTTCAGCCTCCG
TCCGAGGCCAGACAGGCCCGTCATCTCGTGTCGCGCTTTCACGACATCGTCGACGACGGTCATCTTATCAAGGTT
GTTCGTTCGCTCTTGTTGGCTCAGGAGGCGTCCATCATGTGGGAGGCCAAGCCCTGGATTAGACTCAAGACCGAG
TCCGATTGGTTGCGGGCTATGAATCGCTTGTTGGTGGGCAGTGAGGGCGCAAAGTCCAATCAGATTTGGGTTCGG
TCTGCTGGCTTTCCCCAGGCCTGGAAGGGTTATCCCAGGATGGAG
Transcript >Ophio5|5164
ATGCGCATGGACGTCATCGGCTACCTAGCCCGAGGCTGTCCGGCTCTACGGCTCGACGATACGCTTCAGCCTCCG
TCCGAGGCCAGACAGGCCCGTCATCTCGTGTCGCGCTTTCACGACATCGTCGACGACGGTCATCTTATCAAGGTT
GTTCGTTCGCTCTTGTTGGCTCAGGAGGCGTCCATCATGTGGGAGGCCAAGCCCTGGATTAGACTCAAGACCGAG
TCCGATTGGTTGCGGGCTATGAATCGCTTGTTGGTGGGCAGTGAGGGCGCAAAGTCCAATCAGATTTGGGTTCGG
TCTGCTGGCTTTCCCCAGGCCTGGAAGGGTTATCCCAGGATGGAGTAG
Gene >Ophio5|5164
ATGCGCATGGACGTCATCGGCTACCTAGCCCGAGGCTGTCCGGCTCTACGGCTCGACGATACGCTTCAGCCTCCG
TCCGAGGCCAGACAGGCCCGTCATCTCGTGTCGCGCTTTCACGACATCGTCGACGACGGTCATCTTATCAAGGTT
GTTCGTTCGCTCTTGTTGGCTCAGGAGGCGTCCATCATGTGGGAGGCCAAGCCCTGGATTAGACTCAAGACCGAG
TCCGATTGGTTGCGGGCTATGAATCGCTTGTTGGTGGGCAGTGAGGGCGCAAAGTCCAATCAGATTTGGGTTCGG
TCTGCTGGCTTTCCCCAGGCCTGGAAGGGTTATCCCAGGATGGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail