Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5163
Gene name
Locationscaffold_415:16387..18269
Strand+
Gene length (bp)1882
Transcript length (bp)1767
Coding sequence length (bp)1764
Protein length (aa) 588

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.2E-11 73 244
PF07690 MFS_1 Major Facilitator Superfamily 1.5E-08 285 492
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 9.0E-10 120 512

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 14 587 1.0E-151
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 12 584 4.0E-102
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 17 550 1.0E-89
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 10 575 9.0E-80
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 34 552 4.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 14 587 1.0E-151
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 12 584 4.0E-102
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 17 550 1.0E-89
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 10 575 9.0E-80
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 34 552 4.0E-60
sp|Q92341|STR3_SCHPO Siderophore iron transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=1 SV=1 7 574 4.0E-59
sp|Q08299|ENB1_YEAST Siderophore iron transporter ENB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENB1 PE=1 SV=1 18 560 5.0E-50
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 21 579 2.0E-45
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 10 559 7.0E-45
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 23 559 1.0E-41
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 93 560 1.0E-41
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 93 560 1.0E-41
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 176 526 1.0E-12
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 25 531 3.0E-09
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 123 328 6.0E-08
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 82 534 7.0E-07
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 120 377 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

Domain # Start End Length
1 66 88 22
2 103 122 19
3 134 151 17
4 161 180 19
5 193 215 22
6 225 247 22
7 278 300 22
8 305 327 22
9 347 364 17
10 384 406 22
11 413 433 20
12 448 470 22
13 477 499 22
14 553 575 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 227.11 108.95 345.27
CcL In ants, during behavior modification 27.74 12.99 42.50
CcD In ants, recently dead 11.95 4.82 19.08

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.001647 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5163
MAKAAHHLFHRAPEEAPRTKEQEHEAKPDSSPTDDDGSDGDSVSVDAQAGVQEAEATTKVWSRTSLILAYVFIWF
IYFVESTQQGVSFGLHPYVTSSFGQHSLTATTGIVSSLVGGLIKLPLAKILDVWGRPQGFAVTTVLGTVGLVMMA
ACDSVKTYAAAQVFYWVGFNGMGYSLSVFIADTSALENRGLMFSYLYSPFLITSWISGPIATAFYNTLGWRWAFG
VFSIITPFVSLPLIVLFAYNLVKAKRLGLMPARSGPRRTLVQSMRHYLIEFDVVGLLLISAGLALFLLPFSIYTY
QPAQWRSPLIICMVVFGVVLLVCFALYEKFLAPIQFLPYRLLVDRTILGAMVLSASTFVAFYIWENYFSSFLQVV
NGLSLTEATYVGKIYVMGSCFWGIATGLLIRLSGRFKWLALYFGVPLTILGVGLMIHFRQPHTHLGYVIMCQIFI
ALAGGTITICEQTAVMAVITHQHAAVVLAVLSMCSSVGGAIGSTIAAAIWTTVFPRKLAELLPPESQAELQAIYG
NLSHQMTFPIGSPTREAINLAYGETQRMMLIPAVAVLFVGLAGVAAWRNVHVKDFKQTKGTVV
Coding >Ophio5|5163
ATGGCTAAAGCGGCGCATCACTTGTTCCATCGCGCCCCCGAGGAAGCTCCGCGGACCAAAGAGCAAGAGCACGAG
GCTAAACCCGACAGCTCTCCAACCGACGATGACGGCTCCGATGGCGACTCCGTCTCCGTCGATGCCCAGGCCGGT
GTCCAGGAGGCTGAGGCAACGACCAAGGTCTGGAGCAGGACGTCGCTGATCCTGGCATACGTCTTCATCTGGTTC
ATCTACTTTGTCGAGTCCACGCAGCAGGGCGTGAGCTTCGGACTCCATCCCTACGTCACCAGCAGCTTCGGGCAA
CACTCGCTCACGGCCACCACCGGTATAGTGTCCTCGCTCGTCGGCGGCCTGATCAAGCTGCCGCTCGCCAAGATT
CTCGATGTCTGGGGCCGTCCTCAGGGCTTCGCTGTCACGACGGTGCTGGGGACCGTTGGCCTCGTCATGATGGCC
GCCTGCGATTCGGTCAAGACCTATGCCGCCGCCCAGGTCTTTTACTGGGTCGGCTTCAACGGCATGGGCTACAGC
CTCTCCGTCTTCATCGCCGACACGTCGGCCCTCGAGAACCGTGGCCTCATGTTCTCCTACTTATACTCGCCCTTC
CTCATAACCTCTTGGATCAGCGGCCCCATCGCCACCGCCTTCTACAACACCCTTGGCTGGCGCTGGGCCTTTGGC
GTCTTCTCCATCATCACCCCTTTCGTCTCGCTGCCCCTCATCGTCCTCTTCGCCTACAACCTTGTCAAGGCCAAG
AGATTGGGCCTGATGCCGGCTCGCAGCGGCCCTCGACGTACGCTGGTCCAGTCGATGCGCCACTACCTGATCGAG
TTCGACGTTGTCGGCCTGCTTCTCATCAGCGCCGGCCTCGCCCTCTTCCTCCTGCCCTTCAGCATCTACACGTAC
CAGCCGGCTCAGTGGCGCTCGCCTCTCATCATCTGCATGGTCGTCTTCGGCGTCGTGCTACTCGTCTGCTTCGCG
CTGTACGAGAAGTTCCTGGCCCCGATCCAGTTCCTCCCGTACCGGCTACTGGTGGACCGGACCATCTTGGGCGCC
ATGGTCTTGTCGGCCTCCACCTTCGTCGCCTTCTACATCTGGGAAAACTACTTCTCGTCCTTTTTGCAGGTCGTC
AACGGCCTGTCTCTGACCGAGGCCACGTACGTCGGCAAGATCTACGTCATGGGCAGCTGCTTCTGGGGCATCGCC
ACCGGCCTCCTCATCCGGCTGTCTGGTCGCTTCAAGTGGCTGGCCCTCTACTTTGGCGTGCCGCTCACTATTCTC
GGCGTCGGCCTCATGATACACTTTCGCCAGCCGCACACGCACCTCGGCTACGTCATCATGTGCCAGATCTTCATC
GCCCTCGCCGGCGGAACCATCACCATTTGCGAGCAGACGGCCGTCATGGCCGTCATCACCCATCAGCACGCCGCC
GTCGTCCTGGCCGTCTTGTCCATGTGTTCGTCCGTCGGCGGCGCCATTGGCAGCACCATCGCGGCCGCCATCTGG
ACCACCGTCTTCCCCCGCAAGCTCGCCGAGCTCCTCCCGCCGGAATCCCAGGCCGAGCTCCAGGCCATCTACGGC
AATCTGAGCCACCAGATGACGTTCCCCATAGGTTCGCCCACCCGAGAGGCCATCAATCTCGCTTACGGTGAGACG
CAGAGGATGATGCTCATCCCCGCCGTCGCCGTCTTGTTCGTTGGCCTGGCCGGAGTCGCCGCTTGGCGAAATGTT
CACGTTAAGGACTTTAAGCAGACAAAGGGCACGGTTGTA
Transcript >Ophio5|5163
ATGGCTAAAGCGGCGCATCACTTGTTCCATCGCGCCCCCGAGGAAGCTCCGCGGACCAAAGAGCAAGAGCACGAG
GCTAAACCCGACAGCTCTCCAACCGACGATGACGGCTCCGATGGCGACTCCGTCTCCGTCGATGCCCAGGCCGGT
GTCCAGGAGGCTGAGGCAACGACCAAGGTCTGGAGCAGGACGTCGCTGATCCTGGCATACGTCTTCATCTGGTTC
ATCTACTTTGTCGAGTCCACGCAGCAGGGCGTGAGCTTCGGACTCCATCCCTACGTCACCAGCAGCTTCGGGCAA
CACTCGCTCACGGCCACCACCGGTATAGTGTCCTCGCTCGTCGGCGGCCTGATCAAGCTGCCGCTCGCCAAGATT
CTCGATGTCTGGGGCCGTCCTCAGGGCTTCGCTGTCACGACGGTGCTGGGGACCGTTGGCCTCGTCATGATGGCC
GCCTGCGATTCGGTCAAGACCTATGCCGCCGCCCAGGTCTTTTACTGGGTCGGCTTCAACGGCATGGGCTACAGC
CTCTCCGTCTTCATCGCCGACACGTCGGCCCTCGAGAACCGTGGCCTCATGTTCTCCTACTTATACTCGCCCTTC
CTCATAACCTCTTGGATCAGCGGCCCCATCGCCACCGCCTTCTACAACACCCTTGGCTGGCGCTGGGCCTTTGGC
GTCTTCTCCATCATCACCCCTTTCGTCTCGCTGCCCCTCATCGTCCTCTTCGCCTACAACCTTGTCAAGGCCAAG
AGATTGGGCCTGATGCCGGCTCGCAGCGGCCCTCGACGTACGCTGGTCCAGTCGATGCGCCACTACCTGATCGAG
TTCGACGTTGTCGGCCTGCTTCTCATCAGCGCCGGCCTCGCCCTCTTCCTCCTGCCCTTCAGCATCTACACGTAC
CAGCCGGCTCAGTGGCGCTCGCCTCTCATCATCTGCATGGTCGTCTTCGGCGTCGTGCTACTCGTCTGCTTCGCG
CTGTACGAGAAGTTCCTGGCCCCGATCCAGTTCCTCCCGTACCGGCTACTGGTGGACCGGACCATCTTGGGCGCC
ATGGTCTTGTCGGCCTCCACCTTCGTCGCCTTCTACATCTGGGAAAACTACTTCTCGTCCTTTTTGCAGGTCGTC
AACGGCCTGTCTCTGACCGAGGCCACGTACGTCGGCAAGATCTACGTCATGGGCAGCTGCTTCTGGGGCATCGCC
ACCGGCCTCCTCATCCGGCTGTCTGGTCGCTTCAAGTGGCTGGCCCTCTACTTTGGCGTGCCGCTCACTATTCTC
GGCGTCGGCCTCATGATACACTTTCGCCAGCCGCACACGCACCTCGGCTACGTCATCATGTGCCAGATCTTCATC
GCCCTCGCCGGCGGAACCATCACCATTTGCGAGCAGACGGCCGTCATGGCCGTCATCACCCATCAGCACGCCGCC
GTCGTCCTGGCCGTCTTGTCCATGTGTTCGTCCGTCGGCGGCGCCATTGGCAGCACCATCGCGGCCGCCATCTGG
ACCACCGTCTTCCCCCGCAAGCTCGCCGAGCTCCTCCCGCCGGAATCCCAGGCCGAGCTCCAGGCCATCTACGGC
AATCTGAGCCACCAGATGACGTTCCCCATAGGTTCGCCCACCCGAGAGGCCATCAATCTCGCTTACGGTGAGACG
CAGAGGATGATGCTCATCCCCGCCGTCGCCGTCTTGTTCGTTGGCCTGGCCGGAGTCGCCGCTTGGCGAAATGTT
CACGTTAAGGACTTTAAGCAGACAAAGGGCACGGTTGTATAG
Gene >Ophio5|5163
ATGGCTAAAGCGGCGCATCACTTGTTCCATCGCGCCCCCGAGGAAGCTCCGCGGACCAAAGAGCAAGAGCACGAG
GCTAAACCCGACAGCTCTCCAACCGACGATGACGGCTCCGATGGCGACTCCGTCTCCGTCGATGCCCAGGCCGGT
GTCCAGGAGGCTGAGGCAACGACCAAGGTCTGGAGCAGGACGTCGCTGATCCTGGCATACGTCTTGTGCGTCTCC
CCCTTGGACCACTGGCTCACTGGTATAAATAAAACTGACGCACGTCGCAGCATCTGGTTCATCTACTTTGTCGAG
TCCACGCAGCAGGGCGTGAGCTTCGGACTCCATCCCTACGTCACCAGCAGCTTCGGGCAACACTCGCTCACGGCC
ACCACCGGTATAGTGTCCTCGCTCGTCGGCGGCCTGATCAAGCTGCCGCTCGCCAAGATTCTCGATGTCTGGGGC
CGTCCTCAGGGCTTCGCTGTCACGACGGTGCTGGGGACCGTTGGCCTCGTCATGATGGCCGCCTGCGATTCGGTC
AAGACCTATGCCGCCGCCCAGGTCTTTTACTGGGTCGGGTGAGTCGTTGTTCCTCTTTTACATCTCCCCCCTTGC
TCACCCTATTCGTCGCAGCTTCAACGGCATGGGCTACAGCCTCTCCGTCTTCATCGCCGACACGTCGGCCCTCGA
GAACCGTGGCCTCATGTTCTCCTACTTATACTCGCCCTTCCTCATAACCTCTTGGATCAGCGGCCCCATCGCCAC
CGCCTTCTACAACACCCTTGGCTGGCGCTGGGCCTTTGGCGTCTTCTCCATCATCACCCCTTTCGTCTCGCTGCC
CCTCATCGTCCTCTTCGCCTACAACCTTGTCAAGGCCAAGAGATTGGGCCTGATGCCGGCTCGCAGCGGCCCTCG
ACGTACGCTGGTCCAGTCGATGCGCCACTACCTGATCGAGTTCGACGTTGTCGGCCTGCTTCTCATCAGCGCCGG
CCTCGCCCTCTTCCTCCTGCCCTTCAGCATCTACACGTACCAGCCGGCTCAGTGGCGCTCGCCTCTCATCATCTG
CATGGTCGTCTTCGGCGTCGTGCTACTCGTCTGCTTCGCGCTGTACGAGAAGTTCCTGGCCCCGATCCAGTTCCT
CCCGTACCGGCTACTGGTGGACCGGACCATCTTGGGCGCCATGGTCTTGTCGGCCTCCACCTTCGTCGCCTTCTA
CATCTGGGAAAACTACTTCTCGTCCTTTTTGCAGGTCGTCAACGGCCTGTCTCTGACCGAGGCCACGTACGTCGG
CAAGATCTACGTCATGGGCAGCTGCTTCTGGGGCATCGCCACCGGCCTCCTCATCCGGCTGTCTGGTCGCTTCAA
GTGGCTGGCCCTCTACTTTGGCGTGCCGCTCACTATTCTCGGCGTCGGCCTCATGATACACTTTCGCCAGCCGCA
CACGCACCTCGGCTACGTCATCATGTGCCAGATCTTCATCGCCCTCGCCGGCGGAACCATCACCATTTGCGAGCA
GACGGCCGTCATGGCCGTCATCACCCATCAGCACGCCGCCGTCGTCCTGGCCGTCTTGTCCATGTGTTCGTCCGT
CGGCGGCGCCATTGGCAGCACCATCGCGGCCGCCATCTGGACCACCGTCTTCCCCCGCAAGCTCGCCGAGCTCCT
CCCGCCGGAATCCCAGGCCGAGCTCCAGGCCATCTACGGCAATCTGAGCCACCAGATGACGTTCCCCATAGGTTC
GCCCACCCGAGAGGCCATCAATCTCGCTTACGGTGAGACGCAGAGGATGATGCTCATCCCCGCCGTCGCCGTCTT
GTTCGTTGGCCTGGCCGGAGTCGCCGCTTGGCGAAATGTTCACGTTAAGGACTTTAAGCAGACAAAGGGCACGGT
TGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail