Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5163
Gene name
Locationscaffold_415:16387..18269
Strand+
Gene length (bp)1882
Transcript length (bp)1767
Coding sequence length (bp)1764
Protein length (aa) 588

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.2E-11 73 244
PF07690 MFS_1 Major Facilitator Superfamily 1.5E-08 285 492
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 9.0E-10 120 512

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 14 587 1.0E-151
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 12 584 4.0E-102
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 17 550 1.0E-89
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 10 575 9.0E-80
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 34 552 4.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 14 587 1.0E-151
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 12 584 4.0E-102
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 17 550 1.0E-89
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 10 575 9.0E-80
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 34 552 4.0E-60
sp|Q92341|STR3_SCHPO Siderophore iron transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=1 SV=1 7 574 4.0E-59
sp|Q08299|ENB1_YEAST Siderophore iron transporter ENB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENB1 PE=1 SV=1 18 560 5.0E-50
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 21 579 2.0E-45
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 10 559 7.0E-45
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 23 559 1.0E-41
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 93 560 1.0E-41
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 93 560 1.0E-41
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 176 526 1.0E-12
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 25 531 3.0E-09
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 123 328 6.0E-08
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 82 534 7.0E-07
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 120 377 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

Domain # Start End Length
1 66 88 22
2 103 122 19
3 134 151 17
4 161 180 19
5 193 215 22
6 225 247 22
7 278 300 22
8 305 327 22
9 347 364 17
10 384 406 22
11 413 433 20
12 448 470 22
13 477 499 22
14 553 575 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5163
MAKAAHHLFHRAPEEAPRTKEQEHEAKPDSSPTDDDGSDGDSVSVDAQAGVQEAEATTKVWSRTSLILAYVFIWF
IYFVESTQQGVSFGLHPYVTSSFGQHSLTATTGIVSSLVGGLIKLPLAKILDVWGRPQGFAVTTVLGTVGLVMMA
ACDSVKTYAAAQVFYWVGFNGMGYSLSVFIADTSALENRGLMFSYLYSPFLITSWISGPIATAFYNTLGWRWAFG
VFSIITPFVSLPLIVLFAYNLVKAKRLGLMPARSGPRRTLVQSMRHYLIEFDVVGLLLISAGLALFLLPFSIYTY
QPAQWRSPLIICMVVFGVVLLVCFALYEKFLAPIQFLPYRLLVDRTILGAMVLSASTFVAFYIWENYFSSFLQVV
NGLSLTEATYVGKIYVMGSCFWGIATGLLIRLSGRFKWLALYFGVPLTILGVGLMIHFRQPHTHLGYVIMCQIFI
ALAGGTITICEQTAVMAVITHQHAAVVLAVLSMCSSVGGAIGSTIAAAIWTTVFPRKLAELLPPESQAELQAIYG
NLSHQMTFPIGSPTREAINLAYGETQRMMLIPAVAVLFVGLAGVAAWRNVHVKDFKQTKGTVV
Coding >Ophio5|5163
ATGGCTAAAGCGGCGCATCACTTGTTCCATCGCGCCCCCGAGGAAGCTCCGCGGACCAAAGAGCAAGAGCACGAG
GCTAAACCCGACAGCTCTCCAACCGACGATGACGGCTCCGATGGCGACTCCGTCTCCGTCGATGCCCAGGCCGGT
GTCCAGGAGGCTGAGGCAACGACCAAGGTCTGGAGCAGGACGTCGCTGATCCTGGCATACGTCTTCATCTGGTTC
ATCTACTTTGTCGAGTCCACGCAGCAGGGCGTGAGCTTCGGACTCCATCCCTACGTCACCAGCAGCTTCGGGCAA
CACTCGCTCACGGCCACCACCGGTATAGTGTCCTCGCTCGTCGGCGGCCTGATCAAGCTGCCGCTCGCCAAGATT
CTCGATGTCTGGGGCCGTCCTCAGGGCTTCGCTGTCACGACGGTGCTGGGGACCGTTGGCCTCGTCATGATGGCC
GCCTGCGATTCGGTCAAGACCTATGCCGCCGCCCAGGTCTTTTACTGGGTCGGCTTCAACGGCATGGGCTACAGC
CTCTCCGTCTTCATCGCCGACACGTCGGCCCTCGAGAACCGTGGCCTCATGTTCTCCTACTTATACTCGCCCTTC
CTCATAACCTCTTGGATCAGCGGCCCCATCGCCACCGCCTTCTACAACACCCTTGGCTGGCGCTGGGCCTTTGGC
GTCTTCTCCATCATCACCCCTTTCGTCTCGCTGCCCCTCATCGTCCTCTTCGCCTACAACCTTGTCAAGGCCAAG
AGATTGGGCCTGATGCCGGCTCGCAGCGGCCCTCGACGTACGCTGGTCCAGTCGATGCGCCACTACCTGATCGAG
TTCGACGTTGTCGGCCTGCTTCTCATCAGCGCCGGCCTCGCCCTCTTCCTCCTGCCCTTCAGCATCTACACGTAC
CAGCCGGCTCAGTGGCGCTCGCCTCTCATCATCTGCATGGTCGTCTTCGGCGTCGTGCTACTCGTCTGCTTCGCG
CTGTACGAGAAGTTCCTGGCCCCGATCCAGTTCCTCCCGTACCGGCTACTGGTGGACCGGACCATCTTGGGCGCC
ATGGTCTTGTCGGCCTCCACCTTCGTCGCCTTCTACATCTGGGAAAACTACTTCTCGTCCTTTTTGCAGGTCGTC
AACGGCCTGTCTCTGACCGAGGCCACGTACGTCGGCAAGATCTACGTCATGGGCAGCTGCTTCTGGGGCATCGCC
ACCGGCCTCCTCATCCGGCTGTCTGGTCGCTTCAAGTGGCTGGCCCTCTACTTTGGCGTGCCGCTCACTATTCTC
GGCGTCGGCCTCATGATACACTTTCGCCAGCCGCACACGCACCTCGGCTACGTCATCATGTGCCAGATCTTCATC
GCCCTCGCCGGCGGAACCATCACCATTTGCGAGCAGACGGCCGTCATGGCCGTCATCACCCATCAGCACGCCGCC
GTCGTCCTGGCCGTCTTGTCCATGTGTTCGTCCGTCGGCGGCGCCATTGGCAGCACCATCGCGGCCGCCATCTGG
ACCACCGTCTTCCCCCGCAAGCTCGCCGAGCTCCTCCCGCCGGAATCCCAGGCCGAGCTCCAGGCCATCTACGGC
AATCTGAGCCACCAGATGACGTTCCCCATAGGTTCGCCCACCCGAGAGGCCATCAATCTCGCTTACGGTGAGACG
CAGAGGATGATGCTCATCCCCGCCGTCGCCGTCTTGTTCGTTGGCCTGGCCGGAGTCGCCGCTTGGCGAAATGTT
CACGTTAAGGACTTTAAGCAGACAAAGGGCACGGTTGTA
Transcript >Ophio5|5163
ATGGCTAAAGCGGCGCATCACTTGTTCCATCGCGCCCCCGAGGAAGCTCCGCGGACCAAAGAGCAAGAGCACGAG
GCTAAACCCGACAGCTCTCCAACCGACGATGACGGCTCCGATGGCGACTCCGTCTCCGTCGATGCCCAGGCCGGT
GTCCAGGAGGCTGAGGCAACGACCAAGGTCTGGAGCAGGACGTCGCTGATCCTGGCATACGTCTTCATCTGGTTC
ATCTACTTTGTCGAGTCCACGCAGCAGGGCGTGAGCTTCGGACTCCATCCCTACGTCACCAGCAGCTTCGGGCAA
CACTCGCTCACGGCCACCACCGGTATAGTGTCCTCGCTCGTCGGCGGCCTGATCAAGCTGCCGCTCGCCAAGATT
CTCGATGTCTGGGGCCGTCCTCAGGGCTTCGCTGTCACGACGGTGCTGGGGACCGTTGGCCTCGTCATGATGGCC
GCCTGCGATTCGGTCAAGACCTATGCCGCCGCCCAGGTCTTTTACTGGGTCGGCTTCAACGGCATGGGCTACAGC
CTCTCCGTCTTCATCGCCGACACGTCGGCCCTCGAGAACCGTGGCCTCATGTTCTCCTACTTATACTCGCCCTTC
CTCATAACCTCTTGGATCAGCGGCCCCATCGCCACCGCCTTCTACAACACCCTTGGCTGGCGCTGGGCCTTTGGC
GTCTTCTCCATCATCACCCCTTTCGTCTCGCTGCCCCTCATCGTCCTCTTCGCCTACAACCTTGTCAAGGCCAAG
AGATTGGGCCTGATGCCGGCTCGCAGCGGCCCTCGACGTACGCTGGTCCAGTCGATGCGCCACTACCTGATCGAG
TTCGACGTTGTCGGCCTGCTTCTCATCAGCGCCGGCCTCGCCCTCTTCCTCCTGCCCTTCAGCATCTACACGTAC
CAGCCGGCTCAGTGGCGCTCGCCTCTCATCATCTGCATGGTCGTCTTCGGCGTCGTGCTACTCGTCTGCTTCGCG
CTGTACGAGAAGTTCCTGGCCCCGATCCAGTTCCTCCCGTACCGGCTACTGGTGGACCGGACCATCTTGGGCGCC
ATGGTCTTGTCGGCCTCCACCTTCGTCGCCTTCTACATCTGGGAAAACTACTTCTCGTCCTTTTTGCAGGTCGTC
AACGGCCTGTCTCTGACCGAGGCCACGTACGTCGGCAAGATCTACGTCATGGGCAGCTGCTTCTGGGGCATCGCC
ACCGGCCTCCTCATCCGGCTGTCTGGTCGCTTCAAGTGGCTGGCCCTCTACTTTGGCGTGCCGCTCACTATTCTC
GGCGTCGGCCTCATGATACACTTTCGCCAGCCGCACACGCACCTCGGCTACGTCATCATGTGCCAGATCTTCATC
GCCCTCGCCGGCGGAACCATCACCATTTGCGAGCAGACGGCCGTCATGGCCGTCATCACCCATCAGCACGCCGCC
GTCGTCCTGGCCGTCTTGTCCATGTGTTCGTCCGTCGGCGGCGCCATTGGCAGCACCATCGCGGCCGCCATCTGG
ACCACCGTCTTCCCCCGCAAGCTCGCCGAGCTCCTCCCGCCGGAATCCCAGGCCGAGCTCCAGGCCATCTACGGC
AATCTGAGCCACCAGATGACGTTCCCCATAGGTTCGCCCACCCGAGAGGCCATCAATCTCGCTTACGGTGAGACG
CAGAGGATGATGCTCATCCCCGCCGTCGCCGTCTTGTTCGTTGGCCTGGCCGGAGTCGCCGCTTGGCGAAATGTT
CACGTTAAGGACTTTAAGCAGACAAAGGGCACGGTTGTATAG
Gene >Ophio5|5163
ATGGCTAAAGCGGCGCATCACTTGTTCCATCGCGCCCCCGAGGAAGCTCCGCGGACCAAAGAGCAAGAGCACGAG
GCTAAACCCGACAGCTCTCCAACCGACGATGACGGCTCCGATGGCGACTCCGTCTCCGTCGATGCCCAGGCCGGT
GTCCAGGAGGCTGAGGCAACGACCAAGGTCTGGAGCAGGACGTCGCTGATCCTGGCATACGTCTTGTGCGTCTCC
CCCTTGGACCACTGGCTCACTGGTATAAATAAAACTGACGCACGTCGCAGCATCTGGTTCATCTACTTTGTCGAG
TCCACGCAGCAGGGCGTGAGCTTCGGACTCCATCCCTACGTCACCAGCAGCTTCGGGCAACACTCGCTCACGGCC
ACCACCGGTATAGTGTCCTCGCTCGTCGGCGGCCTGATCAAGCTGCCGCTCGCCAAGATTCTCGATGTCTGGGGC
CGTCCTCAGGGCTTCGCTGTCACGACGGTGCTGGGGACCGTTGGCCTCGTCATGATGGCCGCCTGCGATTCGGTC
AAGACCTATGCCGCCGCCCAGGTCTTTTACTGGGTCGGGTGAGTCGTTGTTCCTCTTTTACATCTCCCCCCTTGC
TCACCCTATTCGTCGCAGCTTCAACGGCATGGGCTACAGCCTCTCCGTCTTCATCGCCGACACGTCGGCCCTCGA
GAACCGTGGCCTCATGTTCTCCTACTTATACTCGCCCTTCCTCATAACCTCTTGGATCAGCGGCCCCATCGCCAC
CGCCTTCTACAACACCCTTGGCTGGCGCTGGGCCTTTGGCGTCTTCTCCATCATCACCCCTTTCGTCTCGCTGCC
CCTCATCGTCCTCTTCGCCTACAACCTTGTCAAGGCCAAGAGATTGGGCCTGATGCCGGCTCGCAGCGGCCCTCG
ACGTACGCTGGTCCAGTCGATGCGCCACTACCTGATCGAGTTCGACGTTGTCGGCCTGCTTCTCATCAGCGCCGG
CCTCGCCCTCTTCCTCCTGCCCTTCAGCATCTACACGTACCAGCCGGCTCAGTGGCGCTCGCCTCTCATCATCTG
CATGGTCGTCTTCGGCGTCGTGCTACTCGTCTGCTTCGCGCTGTACGAGAAGTTCCTGGCCCCGATCCAGTTCCT
CCCGTACCGGCTACTGGTGGACCGGACCATCTTGGGCGCCATGGTCTTGTCGGCCTCCACCTTCGTCGCCTTCTA
CATCTGGGAAAACTACTTCTCGTCCTTTTTGCAGGTCGTCAACGGCCTGTCTCTGACCGAGGCCACGTACGTCGG
CAAGATCTACGTCATGGGCAGCTGCTTCTGGGGCATCGCCACCGGCCTCCTCATCCGGCTGTCTGGTCGCTTCAA
GTGGCTGGCCCTCTACTTTGGCGTGCCGCTCACTATTCTCGGCGTCGGCCTCATGATACACTTTCGCCAGCCGCA
CACGCACCTCGGCTACGTCATCATGTGCCAGATCTTCATCGCCCTCGCCGGCGGAACCATCACCATTTGCGAGCA
GACGGCCGTCATGGCCGTCATCACCCATCAGCACGCCGCCGTCGTCCTGGCCGTCTTGTCCATGTGTTCGTCCGT
CGGCGGCGCCATTGGCAGCACCATCGCGGCCGCCATCTGGACCACCGTCTTCCCCCGCAAGCTCGCCGAGCTCCT
CCCGCCGGAATCCCAGGCCGAGCTCCAGGCCATCTACGGCAATCTGAGCCACCAGATGACGTTCCCCATAGGTTC
GCCCACCCGAGAGGCCATCAATCTCGCTTACGGTGAGACGCAGAGGATGATGCTCATCCCCGCCGTCGCCGTCTT
GTTCGTTGGCCTGGCCGGAGTCGCCGCTTGGCGAAATGTTCACGTTAAGGACTTTAAGCAGACAAAGGGCACGGT
TGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail