Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5162
Gene name
Locationscaffold_415:10720..14874
Strand+
Gene length (bp)4154
Transcript length (bp)4083
Coding sequence length (bp)4080
Protein length (aa) 1360

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00664 ABC_membrane ABC transporter transmembrane region 1.1E-41 39 296
PF00664 ABC_membrane ABC transporter transmembrane region 7.8E-38 751 1020
PF00005 ABC_tran ABC transporter 2.0E-30 391 582
PF00005 ABC_tran ABC transporter 2.1E-27 1108 1277

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 17 1360 0.0E+00
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 22 1343 0.0E+00
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 34 1341 0.0E+00
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 34 1341 0.0E+00
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 34 1341 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 17 1360 0.0E+00
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 22 1343 0.0E+00
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 34 1341 0.0E+00
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 34 1341 0.0E+00
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 34 1341 0.0E+00
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 22 1341 0.0E+00
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 34 1341 9.0E-180
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 35 1341 1.0E-179
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 35 1341 2.0E-179
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 34 1343 2.0E-178
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 22 1341 3.0E-178
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 34 1341 3.0E-178
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 34 1341 6.0E-178
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 34 1358 7.0E-178
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 22 1341 2.0E-176
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 34 1348 9.0E-174
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 35 1341 3.0E-172
sp|Q9SYI2|AB3B_ARATH ABC transporter B family member 3 OS=Arabidopsis thaliana GN=ABCB3 PE=3 SV=1 22 1341 3.0E-172
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 35 1341 1.0E-171
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 34 1344 2.0E-171
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 35 1341 3.0E-171
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 22 1344 1.0E-170
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 34 1341 2.0E-170
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 34 1341 1.0E-168
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 34 1341 7.0E-168
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 34 1341 6.0E-167
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 35 1341 1.0E-166
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 71 1341 2.0E-166
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 22 1346 6.0E-166
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 34 1358 8.0E-165
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 22 1341 4.0E-164
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 5 1343 7.0E-164
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 21 1341 9.0E-160
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 15 1341 4.0E-158
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 18 1341 4.0E-155
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 3 1341 6.0E-155
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 25 1348 3.0E-153
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 34 1343 2.0E-147
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 35 1341 6.0E-144
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 17 1341 6.0E-144
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 34 1341 3.0E-132
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 84 1341 2.0E-131
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 35 1349 1.0E-126
sp|P13568|MDR_PLAFF Multidrug resistance protein OS=Plasmodium falciparum (isolate FC27 / Papua New Guinea) GN=MDR1 PE=3 SV=1 38 1341 2.0E-111
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 33 653 7.0E-93
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 35 1341 5.0E-85
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 25 653 6.0E-81
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 35 654 1.0E-77
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 35 654 5.0E-76
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 3 650 8.0E-76
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 35 654 5.0E-75
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 32 650 7.0E-75
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 743 1355 7.0E-75
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 30 650 1.0E-74
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 20 654 3.0E-74
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 13 640 5.0E-73
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 22 653 5.0E-73
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 35 654 4.0E-72
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 38 651 1.0E-71
sp|Q9CXJ4|ABCB8_MOUSE ATP-binding cassette sub-family B member 8, mitochondrial OS=Mus musculus GN=Abcb8 PE=1 SV=1 111 680 1.0E-71
sp|Q9JI39|ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus GN=Abcb10 PE=1 SV=1 59 656 1.0E-70
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 22 654 3.0E-70
sp|Q5RKI8|ABCB8_RAT ATP-binding cassette sub-family B member 8, mitochondrial OS=Rattus norvegicus GN=Abcb8 PE=2 SV=1 111 655 4.0E-70
sp|B2GUP8|ABCB8_XENTR ATP-binding cassette sub-family B member 8, mitochondrial OS=Xenopus tropicalis GN=abcb8 PE=2 SV=1 20 653 5.0E-70
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 35 653 8.0E-70
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 6 655 1.0E-69
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 22 654 2.0E-69
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 18 656 2.0E-69
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 22 676 2.0E-69
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 789 1346 9.0E-69
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 38 651 1.0E-68
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 35 654 2.0E-68
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 22 654 2.0E-68
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 59 656 3.0E-68
sp|Q5RFQ9|ABCB8_PONAB ATP-binding cassette sub-family B member 8, mitochondrial OS=Pongo abelii GN=ABCB8 PE=2 SV=1 111 655 3.0E-68
sp|Q54W24|ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum GN=abcB4 PE=3 SV=1 40 650 3.0E-68
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 22 654 4.0E-68
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 5 656 6.0E-68
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 22 653 1.0E-67
sp|Q9NUT2|ABCB8_HUMAN ATP-binding cassette sub-family B member 8, mitochondrial OS=Homo sapiens GN=ABCB8 PE=1 SV=3 111 655 1.0E-67
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 38 651 2.0E-67
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 167 1344 2.0E-67
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 35 650 3.0E-67
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 79 653 9.0E-67
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 723 1341 9.0E-67
sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 24 653 9.0E-67
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 745 1346 1.0E-66
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 19 653 2.0E-66
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 746 1356 3.0E-66
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 783 1356 3.0E-66
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 22 651 4.0E-66
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 723 1357 4.0E-66
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 783 1356 9.0E-66
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 746 1356 2.0E-65
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 746 1356 2.0E-65
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 38 650 2.0E-65
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 110 656 2.0E-65
sp|Q56A55|ABCB8_DANRE ATP-binding cassette sub-family B member 8, mitochondrial OS=Danio rerio GN=abcb8 PE=2 SV=1 111 653 2.0E-65
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 819 1341 6.0E-65
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 746 1358 7.0E-65
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 745 1346 8.0E-65
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 22 657 8.0E-65
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 745 1358 9.0E-63
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 776 1356 1.0E-62
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 746 1358 1.0E-62
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 34 653 1.0E-62
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 22 653 2.0E-62
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 806 1356 7.0E-62
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 742 1346 2.0E-61
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 34 653 2.0E-61
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 746 1356 3.0E-61
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 795 1346 6.0E-61
sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 721 1346 9.0E-61
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 745 1346 2.0E-60
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 806 1356 2.0E-60
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 745 1346 3.0E-60
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 804 1356 2.0E-59
sp|P33311|MDL2_YEAST ATP-dependent permease MDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL2 PE=1 SV=3 59 639 2.0E-59
sp|Q6AJW3|MSBA_DESPS Lipid A export ATP-binding/permease protein MsbA OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=msbA PE=3 SV=1 90 653 1.0E-58
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 4 655 2.0E-58
sp|Q66CI3|MSBA_YERPS Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msbA PE=3 SV=1 101 653 2.0E-58
sp|Q1CGH0|MSBA_YERPN Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msbA PE=3 SV=1 101 653 2.0E-58
sp|Q8ZGA9|MSBA_YERPE Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis GN=msbA PE=3 SV=1 101 653 2.0E-58
sp|Q1CA68|MSBA_YERPA Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msbA PE=3 SV=1 101 653 2.0E-58
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 24 655 7.0E-58
sp|Q9JI39|ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus GN=Abcb10 PE=1 SV=1 821 1355 8.0E-58
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 811 1358 1.0E-57
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 24 669 1.0E-57
sp|Q9GTN7|TAGA_DICDI Serine protease/ABC transporter B family protein tagA OS=Dictyostelium discoideum GN=tagA PE=1 SV=2 85 672 1.0E-57
sp|Q21NS8|MSBA_SACD2 Lipid A export ATP-binding/permease protein MsbA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msbA PE=3 SV=1 93 653 4.0E-57
sp|Q32E34|MSBA_SHIDS Lipid A export ATP-binding/permease protein MsbA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msbA PE=3 SV=1 90 653 5.0E-57
sp|Q31YT6|MSBA_SHIBS Lipid A export ATP-binding/permease protein MsbA OS=Shigella boydii serotype 4 (strain Sb227) GN=msbA PE=3 SV=1 90 653 5.0E-57
sp|P60752|MSBA_ECOLI Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain K12) GN=msbA PE=1 SV=1 90 653 5.0E-57
sp|P60753|MSBA_ECO57 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O157:H7 GN=msbA PE=3 SV=1 90 653 5.0E-57
sp|P33310|MDL1_YEAST ATP-dependent permease MDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL1 PE=1 SV=2 59 662 5.0E-57
sp|Q1RDU4|MSBA_ECOUT Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain UTI89 / UPEC) GN=msbA PE=3 SV=1 90 653 8.0E-57
sp|Q8FJB1|MSBA_ECOL6 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msbA PE=3 SV=1 90 653 8.0E-57
sp|Q0TJD9|MSBA_ECOL5 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msbA PE=3 SV=1 90 653 8.0E-57
sp|Q5PGH0|MSBA_SALPA Lipid A export ATP-binding/permease protein MsbA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=msbA PE=3 SV=1 90 653 9.0E-57
sp|Q83LP0|MSBA_SHIFL Lipid A export ATP-binding/permease protein MsbA OS=Shigella flexneri GN=msbA PE=3 SV=1 90 653 9.0E-57
sp|Q3Z3K7|MSBA_SHISS Lipid A export ATP-binding/permease protein MsbA OS=Shigella sonnei (strain Ss046) GN=msbA PE=3 SV=1 90 653 9.0E-57
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 725 1341 1.0E-56
sp|P63359|MSBA_SALTY Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=msbA PE=1 SV=1 90 653 1.0E-56
sp|P63360|MSBA_SALTI Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhi GN=msbA PE=3 SV=1 90 653 1.0E-56
sp|Q57R14|MSBA_SALCH Lipid A export ATP-binding/permease protein MsbA OS=Salmonella choleraesuis (strain SC-B67) GN=msbA PE=3 SV=1 90 653 1.0E-56
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 723 1356 2.0E-56
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 22 657 2.0E-56
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 17 654 2.0E-56
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 745 1360 4.0E-56
sp|Q9CXJ4|ABCB8_MOUSE ATP-binding cassette sub-family B member 8, mitochondrial OS=Mus musculus GN=Abcb8 PE=1 SV=1 817 1358 4.0E-56
sp|Q5RFQ9|ABCB8_PONAB ATP-binding cassette sub-family B member 8, mitochondrial OS=Pongo abelii GN=ABCB8 PE=2 SV=1 817 1358 4.0E-56
sp|Q9SYI2|AB3B_ARATH ABC transporter B family member 3 OS=Arabidopsis thaliana GN=ABCB3 PE=3 SV=1 745 1346 5.0E-56
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 104 653 7.0E-56
sp|Q7N6C6|MSBA_PHOLL Lipid A export ATP-binding/permease protein MsbA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msbA PE=3 SV=1 74 653 3.0E-55
sp|Q5RKI8|ABCB8_RAT ATP-binding cassette sub-family B member 8, mitochondrial OS=Rattus norvegicus GN=Abcb8 PE=2 SV=1 783 1358 4.0E-55
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 806 1355 5.0E-55
sp|Q6D437|MSBA_PECAS Lipid A export ATP-binding/permease protein MsbA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msbA PE=3 SV=2 104 653 5.0E-55
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 104 653 7.0E-55
sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 794 1344 1.0E-54
sp|Q9NUT2|ABCB8_HUMAN ATP-binding cassette sub-family B member 8, mitochondrial OS=Homo sapiens GN=ABCB8 PE=1 SV=3 817 1358 3.0E-54
sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 21 653 7.0E-54
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 724 1359 9.0E-54
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 822 1344 1.0E-53
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 809 1346 3.0E-53
sp|Q56A55|ABCB8_DANRE ATP-binding cassette sub-family B member 8, mitochondrial OS=Danio rerio GN=abcb8 PE=2 SV=1 817 1355 3.0E-53
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 724 1359 4.0E-53
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 723 1359 6.0E-53
sp|Q8RY46|AB26B_ARATH ABC transporter B family member 26, chloroplastic OS=Arabidopsis thaliana GN=ABCB26 PE=2 SV=1 117 653 6.0E-53
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 38 653 7.0E-53
sp|Q54W24|ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum GN=abcB4 PE=3 SV=1 804 1348 8.0E-53
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 22 653 1.0E-52
sp|Q5P2S7|MSBA_AROAE Lipid A export ATP-binding/permease protein MsbA OS=Aromatoleum aromaticum (strain EbN1) GN=msbA PE=3 SV=1 117 649 1.0E-52
sp|Q5E0F2|MSBA_VIBF1 Lipid A export ATP-binding/permease protein MsbA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=msbA PE=3 SV=1 104 653 1.0E-52
sp|Q9Y7M7|MDL1_SCHPO ATP-dependent permease MDL1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdl1 PE=3 SV=1 112 653 2.0E-52
sp|Q2NUA5|MSBA_SODGM Lipid A export ATP-binding/permease protein MsbA OS=Sodalis glossinidius (strain morsitans) GN=msbA PE=3 SV=1 90 653 2.0E-52
sp|Q9KQW9|MSBA_VIBCH Lipid A export ATP-binding/permease protein MsbA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msbA PE=1 SV=1 104 653 3.0E-52
sp|Q3SFZ6|MSBA_THIDA Lipid A export ATP-binding/permease protein MsbA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=msbA PE=3 SV=1 24 649 3.0E-52
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 722 1355 6.0E-52
sp|Q7NZU6|MSBA_CHRVO Lipid A export ATP-binding/permease protein MsbA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=msbA PE=3 SV=1 75 649 6.0E-52
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 822 1344 8.0E-52
sp|O31708|YKNV_BACSU Uncharacterized ABC transporter ATP-binding protein YknV OS=Bacillus subtilis (strain 168) GN=yknV PE=3 SV=1 20 653 9.0E-52
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 704 1344 1.0E-51
sp|B2GUP8|ABCB8_XENTR ATP-binding cassette sub-family B member 8, mitochondrial OS=Xenopus tropicalis GN=abcb8 PE=2 SV=1 817 1358 2.0E-51
sp|Q5QU36|MSBA_IDILO Lipid A export ATP-binding/permease protein MsbA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=msbA PE=3 SV=1 114 646 2.0E-51
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 9 653 3.0E-51
sp|P97998|MDL1_CANAX ATP-dependent permease MDL1 OS=Candida albicans GN=MDL1 PE=3 SV=1 700 1341 6.0E-51
sp|Q0I4C5|MSBA_HAES1 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus somnus (strain 129Pt) GN=msbA PE=3 SV=1 89 653 8.0E-51
sp|P97998|MDL1_CANAX ATP-dependent permease MDL1 OS=Candida albicans GN=MDL1 PE=3 SV=1 90 639 1.0E-50
sp|Q3IGX5|MSBA_PSEHT Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=msbA PE=3 SV=1 74 653 1.0E-50
sp|Q9GTN7|TAGA_DICDI Serine protease/ABC transporter B family protein tagA OS=Dictyostelium discoideum GN=tagA PE=1 SV=2 820 1355 2.0E-50
sp|Q9HUG8|MSBA_PSEAE Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msbA PE=3 SV=1 8 649 2.0E-50
sp|Q87R16|MSBA_VIBPA Lipid A export ATP-binding/permease protein MsbA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msbA PE=3 SV=1 117 653 2.0E-50
sp|Q03519|TAP2_HUMAN Antigen peptide transporter 2 OS=Homo sapiens GN=TAP2 PE=1 SV=1 108 627 3.0E-50
sp|Q7VL52|MSBA_HAEDU Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=msbA PE=3 SV=1 101 653 3.0E-50
sp|Q21WN9|MSBA_RHOFT Lipid A export ATP-binding/permease protein MsbA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=msbA PE=3 SV=1 93 653 3.0E-50
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 306 640 3.0E-50
sp|P21958|TAP1_MOUSE Antigen peptide transporter 1 OS=Mus musculus GN=Tap1 PE=1 SV=3 61 658 4.0E-50
sp|P55469|Y4GM_RHISN Uncharacterized ABC transporter ATP-binding protein y4gM OS=Rhizobium sp. (strain NGR234) GN=NGR_a03510 PE=3 SV=1 77 653 5.0E-50
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 813 1358 6.0E-50
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 96 652 7.0E-50
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 96 652 7.0E-50
sp|P36370|TAP1_RAT Antigen peptide transporter 1 OS=Rattus norvegicus GN=Tap1 PE=1 SV=2 61 658 7.0E-50
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 96 652 1.0E-49
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 96 652 1.0E-49
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 12 649 1.0E-49
sp|Q9CHL8|LMRA_LACLA Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lmrA PE=1 SV=2 5 657 1.0E-49
sp|Q9ZCM8|Y696_RICPR Putative export ATP-binding/permease protein RP696 OS=Rickettsia prowazekii (strain Madrid E) GN=RP696 PE=3 SV=1 785 1350 2.0E-49
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 104 653 2.0E-49
sp|O07549|YHEH_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH OS=Bacillus subtilis (strain 168) GN=yheH PE=1 SV=1 80 653 2.0E-49
sp|Q1QX69|MSBA_CHRSD Lipid A export ATP-binding/permease protein MsbA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=msbA PE=3 SV=1 817 1341 2.0E-49
sp|Q8P8W4|MSBA_XANCP Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=msbA PE=3 SV=1 104 649 3.0E-49
sp|Q4UV65|MSBA_XANC8 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=msbA PE=3 SV=1 104 649 3.0E-49
sp|P97046|LMRA_LACLM Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lmrA PE=3 SV=3 5 657 3.0E-49
sp|Q28433|TAP1_GORGO Antigen peptide transporter 1 OS=Gorilla gorilla gorilla GN=TAP1 PE=2 SV=2 78 654 3.0E-49
sp|Q4KJB2|MSBA_PSEF5 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msbA PE=3 SV=1 117 649 4.0E-49
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 813 1358 5.0E-49
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 86 647 5.0E-49
sp|Q0WML0|AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana GN=ABCB27 PE=1 SV=1 808 1355 8.0E-49
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 813 1348 1.0E-48
sp|Q0WML0|AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana GN=ABCB27 PE=1 SV=1 370 653 1.0E-48
sp|Q68W42|Y691_RICTY Putative export ATP-binding/permease protein RT0691 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0691 PE=3 SV=1 785 1350 1.0E-48
sp|Q3SP57|NDVA_NITWN Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ndvA PE=3 SV=2 187 673 1.0E-48
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 196 653 1.0E-48
sp|Q83D84|MSBA_COXBU Lipid A export ATP-binding/permease protein MsbA OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=msbA PE=3 SV=1 98 653 2.0E-48
sp|Q8D2U8|MSBA_WIGBR Lipid A export ATP-binding/permease protein MsbA OS=Wigglesworthia glossinidia brevipalpis GN=msbA PE=3 SV=1 104 653 2.0E-48
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 865 1341 2.0E-48
sp|Q1RJ91|Y492_RICBR Putative export ATP-binding/permease protein RBE_0492 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0492 PE=3 SV=1 817 1349 3.0E-48
sp|Q03518|TAP1_HUMAN Antigen peptide transporter 1 OS=Homo sapiens GN=TAP1 PE=1 SV=2 61 654 3.0E-48
sp|Q492S9|MSBA_BLOPB Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia pennsylvanicus (strain BPEN) GN=msbA PE=3 SV=1 116 653 3.0E-48
sp|Q8RY46|AB26B_ARATH ABC transporter B family member 26, chloroplastic OS=Arabidopsis thaliana GN=ABCB26 PE=2 SV=1 814 1341 4.0E-48
sp|Q57180|Y1051_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1051 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1051 PE=3 SV=1 21 654 4.0E-48
sp|Q4QPI4|MSBA_HAEI8 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain 86-028NP) GN=msbA PE=3 SV=1 91 653 4.0E-48
sp|Q13BH6|NDVA_RHOPS Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB5) GN=ndvA PE=3 SV=1 187 653 5.0E-48
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 811 1358 6.0E-48
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 730 1341 6.0E-48
sp|Q7MJ07|MSBA_VIBVY Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain YJ016) GN=msbA PE=3 SV=2 97 659 6.0E-48
sp|Q8DAV2|MSBA_VIBVU Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain CMCP6) GN=msbA PE=3 SV=1 97 659 6.0E-48
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 809 1348 7.0E-48
sp|Q1GZI0|MSBA_METFK Lipid A export ATP-binding/permease protein MsbA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=msbA PE=3 SV=1 96 653 8.0E-48
sp|Q1QH37|NDVA_NITHX Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ndvA PE=3 SV=1 185 659 1.0E-47
sp|Q483B6|MSBA1_COLP3 Lipid A export ATP-binding/permease protein MsbA 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA1 PE=3 SV=1 2 649 1.0E-47
sp|P44407|MSBA_HAEIN Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=msbA PE=3 SV=1 91 649 2.0E-47
sp|Q87R16|MSBA_VIBPA Lipid A export ATP-binding/permease protein MsbA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msbA PE=3 SV=1 794 1348 3.0E-47
sp|Q8DAV2|MSBA_VIBVU Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain CMCP6) GN=msbA PE=3 SV=1 794 1348 3.0E-47
sp|Q0A4U4|MSBA_ALKEH Lipid A export ATP-binding/permease protein MsbA OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=msbA PE=3 SV=1 97 653 3.0E-47
sp|Q7MJ07|MSBA_VIBVY Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain YJ016) GN=msbA PE=3 SV=2 794 1348 4.0E-47
sp|P35598|EXP8_STRPN Putative ABC transporter ATP-binding protein exp8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp8 PE=3 SV=3 76 654 4.0E-47
sp|Q5H0H0|MSBA_XANOR Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=msbA PE=3 SV=1 89 649 4.0E-47
sp|Q2P3E7|MSBA_XANOM Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=msbA PE=3 SV=1 89 649 4.0E-47
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 804 1341 6.0E-47
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 117 653 7.0E-47
sp|P0DKX5|CYAB_BORPE Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cyaB PE=3 SV=1 871 1341 9.0E-47
sp|Q65U21|MSBA_MANSM Lipid A export ATP-binding/permease protein MsbA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=msbA PE=3 SV=2 89 653 9.0E-47
sp|P0DKX6|CYAB_BORP1 Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) GN=cyaB PE=3 SV=1 871 1341 9.0E-47
sp|Q9KQW9|MSBA_VIBCH Lipid A export ATP-binding/permease protein MsbA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msbA PE=1 SV=1 810 1341 1.0E-46
sp|Q6N1Y7|NDVA_RHOPA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ndvA PE=3 SV=1 185 653 1.0E-46
sp|Q7RX59|ATM1_NEUCR Iron-sulfur clusters transporter atm1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-4 PE=3 SV=1 812 1348 1.0E-46
sp|Q0A4U4|MSBA_ALKEH Lipid A export ATP-binding/permease protein MsbA OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=msbA PE=3 SV=1 789 1341 2.0E-46
sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 115 655 2.0E-46
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 667 1338 3.0E-46
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 865 1346 3.0E-46
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 865 1346 3.0E-46
sp|Q3BTC8|MSBA_XANC5 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=msbA PE=3 SV=1 89 649 3.0E-46
sp|Q87VF3|MSBA_PSESM Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=msbA PE=3 SV=2 1 649 3.0E-46
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 865 1346 3.0E-46
sp|Q6AJW3|MSBA_DESPS Lipid A export ATP-binding/permease protein MsbA OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=msbA PE=3 SV=1 793 1349 4.0E-46
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 865 1346 4.0E-46
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 865 1346 4.0E-46
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 865 1343 4.0E-46
sp|Q3KJ31|MSBA_PSEPF Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf0-1) GN=msbA PE=3 SV=1 22 649 4.0E-46
sp|Q8PKS5|MSBA_XANAC Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=msbA PE=3 SV=1 89 649 4.0E-46
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 865 1346 4.0E-46
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 865 1346 4.0E-46
sp|Q5ZUH9|MSBA_LEGPH Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=msbA PE=3 SV=2 813 1341 4.0E-46
sp|Q21NS8|MSBA_SACD2 Lipid A export ATP-binding/permease protein MsbA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msbA PE=3 SV=1 825 1350 5.0E-46
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 865 1346 5.0E-46
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 771 1349 5.0E-46
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 771 1349 5.0E-46
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 771 1349 5.0E-46
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 771 1349 5.0E-46
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 771 1349 5.0E-46
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 771 1349 5.0E-46
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 771 1349 5.0E-46
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 771 1349 5.0E-46
sp|Q4UMZ3|Y214_RICFE Putative export ATP-binding/permease protein RF_0214 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0214 PE=3 SV=2 817 1355 6.0E-46
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 865 1346 6.0E-46
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 142 655 6.0E-46
sp|Q5ZUH9|MSBA_LEGPH Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=msbA PE=3 SV=2 117 653 7.0E-46
sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=2 SV=1 116 653 7.0E-46
sp|P63398|Y1303_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1303c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1303c PE=3 SV=1 103 652 7.0E-46
sp|P9WQJ3|Y1272_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1272c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1272c PE=1 SV=1 103 652 7.0E-46
sp|P9WQJ2|Y1272_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1310 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1310 PE=3 SV=1 103 652 7.0E-46
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 865 1341 7.0E-46
sp|Q9Y7M7|MDL1_SCHPO ATP-dependent permease MDL1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdl1 PE=3 SV=1 844 1343 8.0E-46
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 82 640 8.0E-46
sp|Q60AA3|MSBA_METCA Lipid A export ATP-binding/permease protein MsbA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=msbA PE=3 SV=1 91 653 8.0E-46
sp|Q20Z38|NDVA_RHOPB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB18) GN=ndvA PE=3 SV=1 187 658 8.0E-46
sp|P0DKX6|CYAB_BORP1 Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) GN=cyaB PE=3 SV=1 40 654 9.0E-46
sp|Q54RU1|ABCB6_DICDI ABC transporter B family member 6 OS=Dictyostelium discoideum GN=abcB6 PE=3 SV=1 171 655 9.0E-46
sp|Q66CI3|MSBA_YERPS Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msbA PE=3 SV=1 799 1341 1.0E-45
sp|Q1CGH0|MSBA_YERPN Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msbA PE=3 SV=1 799 1341 1.0E-45
sp|Q8ZGA9|MSBA_YERPE Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis GN=msbA PE=3 SV=1 799 1341 1.0E-45
sp|Q1CA68|MSBA_YERPA Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msbA PE=3 SV=1 799 1341 1.0E-45
sp|Q83LP0|MSBA_SHIFL Lipid A export ATP-binding/permease protein MsbA OS=Shigella flexneri GN=msbA PE=3 SV=1 809 1341 1.0E-45
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 849 1341 1.0E-45
sp|P55469|Y4GM_RHISN Uncharacterized ABC transporter ATP-binding protein y4gM OS=Rhizobium sp. (strain NGR234) GN=NGR_a03510 PE=3 SV=1 851 1349 1.0E-45
sp|P0DKX5|CYAB_BORPE Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cyaB PE=3 SV=1 54 654 1.0E-45
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 865 1346 1.0E-45
sp|Q89UT8|NDVA_BRADU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ndvA PE=3 SV=1 180 665 1.0E-45
sp|Q8LPQ6|AB28B_ARATH ABC transporter B family member 28 OS=Arabidopsis thaliana GN=ABCB28 PE=2 SV=1 115 653 1.0E-45
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 865 1343 1.0E-45
sp|Q32E34|MSBA_SHIDS Lipid A export ATP-binding/permease protein MsbA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msbA PE=3 SV=1 809 1341 2.0E-45
sp|Q31YT6|MSBA_SHIBS Lipid A export ATP-binding/permease protein MsbA OS=Shigella boydii serotype 4 (strain Sb227) GN=msbA PE=3 SV=1 809 1341 2.0E-45
sp|P60752|MSBA_ECOLI Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain K12) GN=msbA PE=1 SV=1 809 1341 2.0E-45
sp|P60753|MSBA_ECO57 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O157:H7 GN=msbA PE=3 SV=1 809 1341 2.0E-45
sp|Q1RDU4|MSBA_ECOUT Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain UTI89 / UPEC) GN=msbA PE=3 SV=1 787 1341 2.0E-45
sp|Q8FJB1|MSBA_ECOL6 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msbA PE=3 SV=1 787 1341 2.0E-45
sp|Q0TJD9|MSBA_ECOL5 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msbA PE=3 SV=1 787 1341 2.0E-45
sp|Q3Z3K7|MSBA_SHISS Lipid A export ATP-binding/permease protein MsbA OS=Shigella sonnei (strain Ss046) GN=msbA PE=3 SV=1 809 1341 2.0E-45
sp|P63359|MSBA_SALTY Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=msbA PE=1 SV=1 787 1341 2.0E-45
sp|P63360|MSBA_SALTI Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhi GN=msbA PE=3 SV=1 787 1341 2.0E-45
sp|Q57R14|MSBA_SALCH Lipid A export ATP-binding/permease protein MsbA OS=Salmonella choleraesuis (strain SC-B67) GN=msbA PE=3 SV=1 787 1341 2.0E-45
sp|Q3KJ31|MSBA_PSEPF Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf0-1) GN=msbA PE=3 SV=1 817 1348 2.0E-45
sp|Q31FG2|MSBA_THICR Lipid A export ATP-binding/permease protein MsbA OS=Thiomicrospira crunogena (strain XCL-2) GN=msbA PE=3 SV=1 366 651 2.0E-45
sp|Q48P40|MSBA_PSE14 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=msbA PE=3 SV=2 117 649 2.0E-45
sp|Q6C6N0|ATM1_YARLI Iron-sulfur clusters transporter ATM1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATM1 PE=3 SV=1 129 661 2.0E-45
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 817 1355 2.0E-45
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 865 1341 2.0E-45
sp|Q12M46|MSBA_SHEDO Lipid A export ATP-binding/permease protein MsbA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=msbA PE=3 SV=1 806 1348 2.0E-45
sp|Q5PGH0|MSBA_SALPA Lipid A export ATP-binding/permease protein MsbA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=msbA PE=3 SV=1 787 1341 3.0E-45
sp|Q5X498|MSBA_LEGPA Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Paris) GN=msbA PE=3 SV=1 117 653 3.0E-45
sp|P71082|YGAD_BACSU Putative multidrug export ATP-binding/permease protein YgaD OS=Bacillus subtilis (strain 168) GN=ygaD PE=3 SV=2 371 655 3.0E-45
sp|Q5WVN2|MSBA_LEGPL Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Lens) GN=msbA PE=3 SV=1 117 653 3.0E-45
sp|Q15UY7|MSBA_PSEA6 Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=msbA PE=3 SV=1 365 662 3.0E-45
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 690 1348 4.0E-45
sp|Q0HTS8|MSBA_SHESR Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-7) GN=msbA PE=3 SV=1 22 653 4.0E-45
sp|Q0HHH4|MSBA_SHESM Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-4) GN=msbA PE=3 SV=1 22 653 4.0E-45
sp|Q080T2|MSBA_SHEFN Lipid A export ATP-binding/permease protein MsbA OS=Shewanella frigidimarina (strain NCIMB 400) GN=msbA PE=3 SV=1 89 653 4.0E-45
sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 114 679 4.0E-45
sp|Q9PEE7|MSBA_XYLFA Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain 9a5c) GN=msbA PE=3 SV=1 75 653 5.0E-45
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 94 653 6.0E-45
sp|Q4QPI4|MSBA_HAEI8 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain 86-028NP) GN=msbA PE=3 SV=1 809 1349 9.0E-45
sp|Q21WN9|MSBA_RHOFT Lipid A export ATP-binding/permease protein MsbA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=msbA PE=3 SV=1 801 1348 1.0E-44
sp|Q5X498|MSBA_LEGPA Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Paris) GN=msbA PE=3 SV=1 813 1341 1.0E-44
sp|Q8EDF0|MSBA_SHEON Lipid A export ATP-binding/permease protein MsbA OS=Shewanella oneidensis (strain MR-1) GN=msbA PE=3 SV=1 22 653 1.0E-44
sp|Q2J0F4|NDVA_RHOP2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain HaA2) GN=ndvA PE=3 SV=1 58 653 1.0E-44
sp|Q2YU20|Y1799_STAAB Putative multidrug export ATP-binding/permease protein SAB1799c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1799c PE=3 SV=1 771 1349 1.0E-44
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 865 1346 1.0E-44
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 129 640 1.0E-44
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 21 648 2.0E-44
sp|Q2NUA5|MSBA_SODGM Lipid A export ATP-binding/permease protein MsbA OS=Sodalis glossinidius (strain morsitans) GN=msbA PE=3 SV=1 809 1355 2.0E-44
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 725 1341 2.0E-44
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 82 640 2.0E-44
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 82 640 2.0E-44
sp|Q5WVN2|MSBA_LEGPL Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Lens) GN=msbA PE=3 SV=1 813 1341 2.0E-44
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 129 640 2.0E-44
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 865 1346 2.0E-44
sp|Q9HUG8|MSBA_PSEAE Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msbA PE=3 SV=1 817 1348 3.0E-44
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 720 1346 3.0E-44
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 865 1346 3.0E-44
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 129 640 3.0E-44
sp|Q4ZZ16|MSBA_PSEU2 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=msbA PE=3 SV=1 117 649 3.0E-44
sp|Q46Y89|MSBA_CUPPJ Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=msbA PE=3 SV=1 1092 1341 3.0E-44
sp|Q87EF0|MSBA_XYLFT Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=msbA PE=3 SV=1 75 653 3.0E-44
sp|Q7NZU6|MSBA_CHRVO Lipid A export ATP-binding/permease protein MsbA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=msbA PE=3 SV=1 816 1341 4.0E-44
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 82 640 4.0E-44
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 82 640 4.0E-44
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 82 640 4.0E-44
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 82 640 4.0E-44
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 82 640 4.0E-44
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 129 640 4.0E-44
sp|Q0VQP5|MSBA_ALCBS Lipid A export ATP-binding/permease protein MsbA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=msbA PE=3 SV=1 342 651 4.0E-44
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 189 653 4.0E-44
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 82 640 5.0E-44
sp|Q8D2U8|MSBA_WIGBR Lipid A export ATP-binding/permease protein MsbA OS=Wigglesworthia glossinidia brevipalpis GN=msbA PE=3 SV=1 809 1344 7.0E-44
sp|Q7RX59|ATM1_NEUCR Iron-sulfur clusters transporter atm1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-4 PE=3 SV=1 115 656 8.0E-44
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 82 640 9.0E-44
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 98 653 9.0E-44
sp|Q7N6C6|MSBA_PHOLL Lipid A export ATP-binding/permease protein MsbA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msbA PE=3 SV=1 794 1348 1.0E-43
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 82 641 1.0E-43
sp|P35598|EXP8_STRPN Putative ABC transporter ATP-binding protein exp8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp8 PE=3 SV=3 794 1341 1.0E-43
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 82 640 1.0E-43
sp|P71082|YGAD_BACSU Putative multidrug export ATP-binding/permease protein YgaD OS=Bacillus subtilis (strain 168) GN=ygaD PE=3 SV=2 743 1349 1.0E-43
sp|Q1QBW0|MSBA_PSYCK Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter cryohalolentis (strain K5) GN=msbA PE=3 SV=1 89 649 1.0E-43
sp|Q4KJB2|MSBA_PSEF5 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msbA PE=3 SV=1 817 1348 2.0E-43
sp|Q2HIE9|ATM1_CHAGB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATM1 PE=3 SV=1 97 669 2.0E-43
sp|Q47JR8|MSBA_DECAR Lipid A export ATP-binding/permease protein MsbA OS=Dechloromonas aromatica (strain RCB) GN=msbA PE=3 SV=1 22 653 2.0E-43
sp|Q6D437|MSBA_PECAS Lipid A export ATP-binding/permease protein MsbA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msbA PE=3 SV=2 809 1341 3.0E-43
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 82 640 3.0E-43
sp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana GN=ABCB23 PE=2 SV=1 190 653 3.0E-43
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 799 1348 3.0E-43
sp|P53706|HST6_CANAW Alpha-factor-transporting ATPase OS=Candida albicans (strain WO-1) GN=HST6 PE=3 SV=1 35 1341 3.0E-43
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 370 655 4.0E-43
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 370 655 4.0E-43
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 370 655 4.0E-43
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 370 655 4.0E-43
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 370 655 4.0E-43
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 370 655 4.0E-43
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 370 655 4.0E-43
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 370 655 4.0E-43
sp|Q080T2|MSBA_SHEFN Lipid A export ATP-binding/permease protein MsbA OS=Shewanella frigidimarina (strain NCIMB 400) GN=msbA PE=3 SV=1 806 1348 4.0E-43
sp|Q4HVU7|ATM1_GIBZE Iron-sulfur clusters transporter ATM1, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ATM1 PE=3 SV=1 118 674 4.0E-43
sp|P44407|MSBA_HAEIN Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=msbA PE=3 SV=1 809 1349 5.0E-43
sp|Q2KYS6|MSBA_BORA1 Lipid A export ATP-binding/permease protein MsbA OS=Bordetella avium (strain 197N) GN=msbA PE=3 SV=1 306 653 5.0E-43
sp|P33311|MDL2_YEAST ATP-dependent permease MDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL2 PE=1 SV=3 802 1341 6.0E-43
sp|Q9CHL8|LMRA_LACLA Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lmrA PE=1 SV=2 814 1355 6.0E-43
sp|P36372|TAP2_RAT Antigen peptide transporter 2 OS=Rattus norvegicus GN=Tap2 PE=2 SV=1 112 653 7.0E-43
sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 115 664 9.0E-43
sp|Q07QX6|NDVA_RHOP5 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisA53) GN=ndvA PE=3 SV=1 180 658 1.0E-42
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 82 655 2.0E-42
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 791 1355 2.0E-42
sp|Q2YU20|Y1799_STAAB Putative multidrug export ATP-binding/permease protein SAB1799c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1799c PE=3 SV=1 370 655 2.0E-42
sp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana GN=ABCB23 PE=2 SV=1 807 1348 2.0E-42
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 1062 1349 2.0E-42
sp|Q2SZW0|MSBA_BURTA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msbA PE=3 SV=1 93 653 2.0E-42
sp|Q2SZW0|MSBA_BURTA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msbA PE=3 SV=1 1089 1348 2.0E-42
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 809 1348 4.0E-42
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 809 1348 4.0E-42
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 809 1348 4.0E-42
sp|Q4HVU7|ATM1_GIBZE Iron-sulfur clusters transporter ATM1, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ATM1 PE=3 SV=1 1087 1344 4.0E-42
sp|Q7VR44|MSBA_BLOFL Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia floridanus GN=msbA PE=3 SV=1 248 653 4.0E-42
sp|Q39E73|MSBA_BURL3 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=msbA PE=3 SV=2 38 653 4.0E-42
sp|P54719|YFIC_BACSU Uncharacterized ABC transporter ATP-binding protein YfiC OS=Bacillus subtilis (strain 168) GN=yfiC PE=3 SV=1 89 653 4.0E-42
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 370 653 4.0E-42
sp|Q1RJ91|Y492_RICBR Putative export ATP-binding/permease protein RBE_0492 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0492 PE=3 SV=1 114 656 5.0E-42
sp|Q08D64|ABCB6_XENTR ATP-binding cassette sub-family B member 6, mitochondrial OS=Xenopus tropicalis GN=abcb6 PE=2 SV=1 167 682 5.0E-42
sp|Q1QX69|MSBA_CHRSD Lipid A export ATP-binding/permease protein MsbA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=msbA PE=3 SV=1 117 653 6.0E-42
sp|Q12M46|MSBA_SHEDO Lipid A export ATP-binding/permease protein MsbA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=msbA PE=3 SV=1 97 653 6.0E-42
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 129 654 6.0E-42
sp|O14286|ATM1_SCHPO Iron-sulfur clusters transporter atm1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atm1 PE=3 SV=2 1087 1348 6.0E-42
sp|Q9NP58|ABCB6_HUMAN ATP-binding cassette sub-family B member 6, mitochondrial OS=Homo sapiens GN=ABCB6 PE=1 SV=1 167 684 6.0E-42
sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 812 1341 7.0E-42
sp|Q1BUV6|MSBA_BURCA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia cenocepacia (strain AU 1054) GN=msbA PE=3 SV=2 37 653 7.0E-42
sp|Q7VL52|MSBA_HAEDU Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=msbA PE=3 SV=1 787 1350 8.0E-42
sp|Q0HTS8|MSBA_SHESR Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-7) GN=msbA PE=3 SV=1 805 1341 9.0E-42
sp|Q0HHH4|MSBA_SHESM Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-4) GN=msbA PE=3 SV=1 805 1341 9.0E-42
sp|Q8EDF0|MSBA_SHEON Lipid A export ATP-binding/permease protein MsbA OS=Shewanella oneidensis (strain MR-1) GN=msbA PE=3 SV=1 805 1341 9.0E-42
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 368 1341 9.0E-42
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 93 653 9.0E-42
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 93 653 9.0E-42
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 93 653 9.0E-42
sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=2 SV=1 1087 1348 1.0E-41
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 91 653 1.0E-41
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 54 686 1.0E-41
sp|Q59R09|ATM1_CANAL Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATM1 PE=3 SV=1 118 641 1.0E-41
sp|Q2K342|NDVA_RHIEC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ndvA PE=3 SV=2 185 660 1.0E-41
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 190 1341 1.0E-41
sp|Q9DC29|ABCB6_MOUSE ATP-binding cassette sub-family B member 6, mitochondrial OS=Mus musculus GN=Abcb6 PE=1 SV=1 167 653 1.0E-41
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 89 649 1.0E-41
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 704 1344 2.0E-41
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 38 654 2.0E-41
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 809 1348 2.0E-41
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 809 1348 2.0E-41
sp|Q65U21|MSBA_MANSM Lipid A export ATP-binding/permease protein MsbA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=msbA PE=3 SV=2 789 1341 2.0E-41
sp|Q87VF3|MSBA_PSESM Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=msbA PE=3 SV=2 817 1348 2.0E-41
sp|Q2HIE9|ATM1_CHAGB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATM1 PE=3 SV=1 812 1359 2.0E-41
sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 805 1341 2.0E-41
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 1089 1348 2.0E-41
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 1089 1348 2.0E-41
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 1089 1348 2.0E-41
sp|Q88D92|MSBA_PSEPK Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas putida (strain KT2440) GN=msbA PE=3 SV=1 817 1341 2.0E-41
sp|O31707|YKNU_BACSU Uncharacterized ABC transporter ATP-binding protein YknU OS=Bacillus subtilis (strain 168) GN=yknU PE=3 SV=3 89 653 2.0E-41
sp|Q4PH16|ATM1_USTMA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATM1 PE=3 SV=1 115 660 2.0E-41
sp|Q5E0F2|MSBA_VIBF1 Lipid A export ATP-binding/permease protein MsbA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=msbA PE=3 SV=1 809 1341 3.0E-41
sp|Q3SFZ6|MSBA_THIDA Lipid A export ATP-binding/permease protein MsbA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=msbA PE=3 SV=1 809 1348 3.0E-41
sp|Q88D92|MSBA_PSEPK Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas putida (strain KT2440) GN=msbA PE=3 SV=1 117 649 3.0E-41
sp|Q3IGX5|MSBA_PSEHT Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=msbA PE=3 SV=1 809 1341 4.0E-41
sp|Q60AA3|MSBA_METCA Lipid A export ATP-binding/permease protein MsbA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=msbA PE=3 SV=1 1089 1341 4.0E-41
sp|O14286|ATM1_SCHPO Iron-sulfur clusters transporter atm1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atm1 PE=3 SV=2 230 653 4.0E-41
sp|P11599|HLYB_PROVU Alpha-hemolysin translocation ATP-binding protein HlyB OS=Proteus vulgaris GN=hlyB PE=3 SV=1 785 1341 4.0E-41
sp|Q2G506|ATM1_NOVAD ATM1-type heavy metal exporter OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atm1 PE=1 SV=1 318 654 5.0E-41
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 129 640 6.0E-41
sp|Q12C33|MSBA_POLSJ Lipid A export ATP-binding/permease protein MsbA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msbA PE=3 SV=1 324 651 6.0E-41
sp|Q704E8|ABCB7_RAT ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus GN=Abcb7 PE=1 SV=1 54 686 6.0E-41
sp|P13568|MDR_PLAFF Multidrug resistance protein OS=Plasmodium falciparum (isolate FC27 / Papua New Guinea) GN=MDR1 PE=3 SV=1 1 651 7.0E-41
sp|Q5QU36|MSBA_IDILO Lipid A export ATP-binding/permease protein MsbA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=msbA PE=3 SV=1 733 1341 7.0E-41
sp|Q7VWD8|MSBA_BORPE Lipid A export ATP-binding/permease protein MsbA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=msbA PE=3 SV=1 244 653 9.0E-41
sp|Q7W9N7|MSBA_BORPA Lipid A export ATP-binding/permease protein MsbA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=msbA PE=3 SV=1 244 653 9.0E-41
sp|Q7WH20|MSBA_BORBR Lipid A export ATP-binding/permease protein MsbA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=msbA PE=3 SV=2 244 653 9.0E-41
sp|Q48P40|MSBA_PSE14 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=msbA PE=3 SV=2 817 1348 1.0E-40
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 1089 1341 1.0E-40
sp|Q0I4C5|MSBA_HAES1 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus somnus (strain 129Pt) GN=msbA PE=3 SV=1 783 1341 2.0E-40
sp|P36370|TAP1_RAT Antigen peptide transporter 1 OS=Rattus norvegicus GN=Tap1 PE=1 SV=2 914 1352 2.0E-40
sp|Q15UY7|MSBA_PSEA6 Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=msbA PE=3 SV=1 796 1341 2.0E-40
sp|Q46Y89|MSBA_CUPPJ Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=msbA PE=3 SV=1 341 653 2.0E-40
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 865 1344 2.0E-40
sp|O70595|ABCB6_RAT ATP-binding cassette sub-family B member 6, mitochondrial OS=Rattus norvegicus GN=Abcb6 PE=2 SV=1 167 653 2.0E-40
sp|P97046|LMRA_LACLM Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lmrA PE=3 SV=3 814 1355 3.0E-40
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 114 653 3.0E-40
sp|Q1MAB5|NDVA_RHIL3 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ndvA PE=3 SV=1 185 660 3.0E-40
sp|Q0VQP5|MSBA_ALCBS Lipid A export ATP-binding/permease protein MsbA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=msbA PE=3 SV=1 813 1348 4.0E-40
sp|Q1LQD3|MSBA_CUPMC Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=msbA PE=3 SV=1 74 653 7.0E-40
sp|Q5F4X8|MSBA_NEIG1 Lipid A export ATP-binding/permease protein MsbA OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=msbA PE=3 SV=1 218 652 8.0E-40
sp|Q751N2|ATM1_ASHGO Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATM1 PE=3 SV=1 129 644 8.0E-40
sp|Q9ZCM8|Y696_RICPR Putative export ATP-binding/permease protein RP696 OS=Rickettsia prowazekii (strain Madrid E) GN=RP696 PE=3 SV=1 59 653 9.0E-40
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 812 1349 9.0E-40
sp|P11599|HLYB_PROVU Alpha-hemolysin translocation ATP-binding protein HlyB OS=Proteus vulgaris GN=hlyB PE=3 SV=1 82 640 9.0E-40
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 93 653 9.0E-40
sp|Q23868|TAGC_DICDI Serine protease/ABC transporter B family protein tagC OS=Dictyostelium discoideum GN=tagC PE=2 SV=2 361 653 1.0E-39
sp|Q89A96|MDLB_BUCBP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlB PE=3 SV=1 773 1358 1.0E-39
sp|Q47JR8|MSBA_DECAR Lipid A export ATP-binding/permease protein MsbA OS=Dechloromonas aromatica (strain RCB) GN=msbA PE=3 SV=1 792 1341 2.0E-39
sp|Q6CX96|ATM1_KLULA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATM1 PE=3 SV=1 118 676 2.0E-39
sp|Q9JXR3|MSBA_NEIMB Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup B (strain MC58) GN=msbA PE=3 SV=1 218 652 2.0E-39
sp|Q4UMZ3|Y214_RICFE Putative export ATP-binding/permease protein RF_0214 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0214 PE=3 SV=2 114 653 3.0E-39
sp|Q4ZZ16|MSBA_PSEU2 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=msbA PE=3 SV=1 817 1348 3.0E-39
sp|P75094|Y019_MYCPN Putative ABC transporter ATP-binding protein MG015 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_019 PE=3 SV=1 90 652 3.0E-39
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 1087 1348 4.0E-39
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 728 1344 4.0E-39
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 1090 1348 4.0E-39
sp|P40416|ATM1_YEAST Iron-sulfur clusters transporter ATM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATM1 PE=1 SV=2 60 644 4.0E-39
sp|Q5H0H0|MSBA_XANOR Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=msbA PE=3 SV=1 797 1341 5.0E-39
sp|Q2P3E7|MSBA_XANOM Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=msbA PE=3 SV=1 797 1341 5.0E-39
sp|P47261|Y015_MYCGE Putative ABC transporter ATP-binding protein MG015 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG015 PE=3 SV=1 74 652 6.0E-39
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 54 686 6.0E-39
sp|Q9DC29|ABCB6_MOUSE ATP-binding cassette sub-family B member 6, mitochondrial OS=Mus musculus GN=Abcb6 PE=1 SV=1 1090 1344 7.0E-39
sp|Q68W42|Y691_RICTY Putative export ATP-binding/permease protein RT0691 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0691 PE=3 SV=1 90 653 1.0E-38
sp|Q1QBW0|MSBA_PSYCK Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter cryohalolentis (strain K5) GN=msbA PE=3 SV=1 794 1348 1.0E-38
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 1089 1354 1.0E-38
sp|P0A2V1|NDVA_RHIRD Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium radiobacter GN=ndvA PE=1 SV=1 171 663 1.0E-38
sp|P0A2V0|NDVA_AGRFC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ndvA PE=3 SV=1 171 663 1.0E-38
sp|Q9JW59|MSBA_NEIMA Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=msbA PE=3 SV=1 218 652 1.0E-38
sp|P21958|TAP1_MOUSE Antigen peptide transporter 1 OS=Mus musculus GN=Tap1 PE=1 SV=3 914 1349 2.0E-38
sp|Q480N3|MSBA2_COLP3 Lipid A export ATP-binding/permease protein MsbA 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA2 PE=3 SV=2 74 653 2.0E-38
sp|Q5P2S7|MSBA_AROAE Lipid A export ATP-binding/permease protein MsbA OS=Aromatoleum aromaticum (strain EbN1) GN=msbA PE=3 SV=1 817 1341 3.0E-38
sp|Q8P8W4|MSBA_XANCP Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=msbA PE=3 SV=1 797 1341 3.0E-38
sp|Q4UV65|MSBA_XANC8 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=msbA PE=3 SV=1 797 1341 3.0E-38
sp|Q492S9|MSBA_BLOPB Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia pennsylvanicus (strain BPEN) GN=msbA PE=3 SV=1 805 1344 3.0E-38
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 920 1350 3.0E-38
sp|P0CL93|ATM1_CRYNB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATM1 PE=3 SV=1 227 653 3.0E-38
sp|P0CL92|ATM1_CRYNJ Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATM1 PE=3 SV=1 227 653 3.0E-38
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 137 653 4.0E-38
sp|Q71ED1|NDVA_AGRVI Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium vitis GN=ndvA PE=3 SV=1 366 667 4.0E-38
sp|Q4PH16|ATM1_USTMA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATM1 PE=3 SV=1 1087 1341 5.0E-38
sp|Q3BTC8|MSBA_XANC5 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=msbA PE=3 SV=1 797 1341 6.0E-38
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 920 1350 6.0E-38
sp|Q8PKS5|MSBA_XANAC Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=msbA PE=3 SV=1 797 1341 7.0E-38
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 1089 1354 7.0E-38
sp|Q704E8|ABCB7_RAT ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus GN=Abcb7 PE=1 SV=1 1089 1354 7.0E-38
sp|P18767|NDVA_RHIME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium meliloti (strain 1021) GN=ndvA PE=1 SV=2 181 665 7.0E-38
sp|Q31FG2|MSBA_THICR Lipid A export ATP-binding/permease protein MsbA OS=Thiomicrospira crunogena (strain XCL-2) GN=msbA PE=3 SV=1 766 1341 9.0E-38
sp|Q1LQD3|MSBA_CUPMC Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=msbA PE=3 SV=1 1092 1348 9.0E-38
sp|P0A4W5|Y1304_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1304c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1304c PE=3 SV=1 734 1358 9.0E-38
sp|P9WQJ1|Y1273_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1273c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1273c PE=1 SV=1 734 1358 9.0E-38
sp|Q2G506|ATM1_NOVAD ATM1-type heavy metal exporter OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atm1 PE=1 SV=1 1089 1360 1.0E-37
sp|P0CL93|ATM1_CRYNB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATM1 PE=3 SV=1 1087 1341 1.0E-37
sp|P0CL92|ATM1_CRYNJ Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATM1 PE=3 SV=1 1087 1341 1.0E-37
sp|P9WQJ0|Y1273_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1311 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1311 PE=3 SV=1 734 1358 1.0E-37
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 1089 1344 2.0E-37
sp|Q8LPQ6|AB28B_ARATH ABC transporter B family member 28 OS=Arabidopsis thaliana GN=ABCB28 PE=2 SV=1 1090 1357 2.0E-37
sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 1087 1341 2.0E-37
sp|P54719|YFIC_BACSU Uncharacterized ABC transporter ATP-binding protein YfiC OS=Bacillus subtilis (strain 168) GN=yfiC PE=3 SV=1 1089 1350 2.0E-37
sp|Q9NP58|ABCB6_HUMAN ATP-binding cassette sub-family B member 6, mitochondrial OS=Homo sapiens GN=ABCB6 PE=1 SV=1 1090 1350 2.0E-37
sp|Q6F9X0|MSBA_ACIAD Lipid A export ATP-binding/permease protein MsbA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=msbA PE=3 SV=1 90 649 2.0E-37
sp|Q1BUV6|MSBA_BURCA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia cenocepacia (strain AU 1054) GN=msbA PE=3 SV=2 1076 1348 3.0E-37
sp|A1USS5|NDVA_BARBK Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ndvA PE=3 SV=1 1065 1344 3.0E-37
sp|Q6BXD7|ATM1_DEBHA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATM1 PE=3 SV=2 118 640 3.0E-37
sp|P70864|NDVA_BARBA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis GN=ndvA PE=3 SV=2 1065 1344 3.0E-37
sp|Q83D84|MSBA_COXBU Lipid A export ATP-binding/permease protein MsbA OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=msbA PE=3 SV=1 795 1341 4.0E-37
sp|Q54RU1|ABCB6_DICDI ABC transporter B family member 6 OS=Dictyostelium discoideum GN=abcB6 PE=3 SV=1 1089 1341 4.0E-37
sp|Q87EF0|MSBA_XYLFT Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=msbA PE=3 SV=1 795 1344 4.0E-37
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 794 1348 4.0E-37
sp|Q28433|TAP1_GORGO Antigen peptide transporter 1 OS=Gorilla gorilla gorilla GN=TAP1 PE=2 SV=2 781 1344 6.0E-37
sp|Q6FZF2|NDVA_BARQU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella quintana (strain Toulouse) GN=ndvA PE=3 SV=1 806 1348 6.0E-37
sp|P77265|MDLA_ECOLI Multidrug resistance-like ATP-binding protein MdlA OS=Escherichia coli (strain K12) GN=mdlA PE=3 SV=1 77 664 6.0E-37
sp|Q483B6|MSBA1_COLP3 Lipid A export ATP-binding/permease protein MsbA 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA1 PE=3 SV=1 795 1341 8.0E-37
sp|Q6G2Z5|NDVA_BARHE Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ndvA PE=3 SV=1 818 1348 9.0E-37
sp|Q03518|TAP1_HUMAN Antigen peptide transporter 1 OS=Homo sapiens GN=TAP1 PE=1 SV=2 781 1344 1.0E-36
sp|Q89UT8|NDVA_BRADU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ndvA PE=3 SV=1 810 1341 1.0E-36
sp|O31707|YKNU_BACSU Uncharacterized ABC transporter ATP-binding protein YknU OS=Bacillus subtilis (strain 168) GN=yknU PE=3 SV=3 805 1349 1.0E-36
sp|Q6FZF2|NDVA_BARQU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella quintana (strain Toulouse) GN=ndvA PE=3 SV=1 325 668 1.0E-36
sp|P77265|MDLA_ECOLI Multidrug resistance-like ATP-binding protein MdlA OS=Escherichia coli (strain K12) GN=mdlA PE=3 SV=1 795 1360 1.0E-36
sp|Q13BH6|NDVA_RHOPS Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB5) GN=ndvA PE=3 SV=1 1083 1348 2.0E-36
sp|Q9PEE7|MSBA_XYLFA Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain 9a5c) GN=msbA PE=3 SV=1 795 1344 2.0E-36
sp|Q2KYS6|MSBA_BORA1 Lipid A export ATP-binding/permease protein MsbA OS=Bordetella avium (strain 197N) GN=msbA PE=3 SV=1 795 1341 2.0E-36
sp|P75094|Y019_MYCPN Putative ABC transporter ATP-binding protein MG015 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_019 PE=3 SV=1 844 1348 2.0E-36
sp|Q9LZB8|AB29B_ARATH ABC transporter B family member 29, chloroplastic OS=Arabidopsis thaliana GN=ABCB29 PE=2 SV=1 1107 1343 2.0E-36
sp|Q9LZB8|AB29B_ARATH ABC transporter B family member 29, chloroplastic OS=Arabidopsis thaliana GN=ABCB29 PE=2 SV=1 349 639 2.0E-36
sp|Q6FIK3|ATM1_CANGA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATM1 PE=3 SV=1 90 674 2.0E-36
sp|Q8G0T8|NDVA_BRUSU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella suis biovar 1 (strain 1330) GN=ndvA PE=3 SV=1 1090 1350 2.0E-36
sp|Q6N1Y7|NDVA_RHOPA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ndvA PE=3 SV=1 1083 1344 3.0E-36
sp|Q39E73|MSBA_BURL3 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=msbA PE=3 SV=2 741 1348 3.0E-36
sp|P0AAG5|MDLB_ECOLI Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli (strain K12) GN=mdlB PE=1 SV=1 117 653 3.0E-36
sp|P0AAG6|MDLB_ECOL6 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdlB PE=3 SV=1 117 653 3.0E-36
sp|P0AAG7|MDLB_ECO57 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O157:H7 GN=mdlB PE=3 SV=1 117 653 3.0E-36
sp|Q20Z38|NDVA_RHOPB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB18) GN=ndvA PE=3 SV=1 1090 1344 4.0E-36
sp|Q7VWD8|MSBA_BORPE Lipid A export ATP-binding/permease protein MsbA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=msbA PE=3 SV=1 795 1341 4.0E-36
sp|Q6G2Z5|NDVA_BARHE Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ndvA PE=3 SV=1 169 652 4.0E-36
sp|O07550|YHEI_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI OS=Bacillus subtilis (strain 168) GN=yheI PE=1 SV=1 793 1357 4.0E-36
sp|Q7W9N7|MSBA_BORPA Lipid A export ATP-binding/permease protein MsbA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=msbA PE=3 SV=1 795 1341 5.0E-36
sp|Q7WH20|MSBA_BORBR Lipid A export ATP-binding/permease protein MsbA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=msbA PE=3 SV=2 795 1341 5.0E-36
sp|Q23868|TAGC_DICDI Serine protease/ABC transporter B family protein tagC OS=Dictyostelium discoideum GN=tagC PE=2 SV=2 1090 1349 5.0E-36
sp|P0C529|NDVA_BRUAB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus biovar 1 (strain 9-941) GN=ndvA PE=3 SV=1 1090 1350 5.0E-36
sp|Q2YQ73|NDVA_BRUA2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus (strain 2308) GN=ndvA PE=1 SV=1 1090 1350 5.0E-36
sp|Q08D64|ABCB6_XENTR ATP-binding cassette sub-family B member 6, mitochondrial OS=Xenopus tropicalis GN=abcb6 PE=2 SV=1 1089 1341 7.0E-36
sp|P40416|ATM1_YEAST Iron-sulfur clusters transporter ATM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATM1 PE=1 SV=2 1090 1341 8.0E-36
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 1085 1341 9.0E-36
sp|Q1GZI0|MSBA_METFK Lipid A export ATP-binding/permease protein MsbA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=msbA PE=3 SV=1 791 1341 1.0E-35
sp|O70595|ABCB6_RAT ATP-binding cassette sub-family B member 6, mitochondrial OS=Rattus norvegicus GN=Abcb6 PE=2 SV=1 1090 1344 1.0E-35
sp|Q8YH20|NDVA_BRUME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ndvA PE=3 SV=1 1090 1350 1.0E-35
sp|Q8K985|MDLA_BUCAP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlA PE=3 SV=1 874 1358 1.0E-35
sp|O07549|YHEH_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH OS=Bacillus subtilis (strain 168) GN=yheH PE=1 SV=1 818 1341 2.0E-35
sp|Q2J0F4|NDVA_RHOP2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain HaA2) GN=ndvA PE=3 SV=1 1083 1341 2.0E-35
sp|Q7VR44|MSBA_BLOFL Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia floridanus GN=msbA PE=3 SV=1 810 1341 2.0E-35
sp|P33310|MDL1_YEAST ATP-dependent permease MDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL1 PE=1 SV=2 797 1341 3.0E-35
sp|Q07QX6|NDVA_RHOP5 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisA53) GN=ndvA PE=3 SV=1 1083 1344 3.0E-35
sp|A1USS5|NDVA_BARBK Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ndvA PE=3 SV=1 325 685 3.0E-35
sp|P54683|TAGB_DICDI Serine protease/ABC transporter B family protein tagB OS=Dictyostelium discoideum GN=tagB PE=3 SV=2 371 649 3.0E-35
sp|Q983H5|NDVA_RHILO Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium loti (strain MAFF303099) GN=ndvA PE=3 SV=1 325 663 4.0E-35
sp|P9WQJ9|IRTA_MYCTU Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtA PE=1 SV=1 1089 1348 4.0E-35
sp|P9WQJ8|IRTA_MYCTO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtA PE=3 SV=1 1089 1348 4.0E-35
sp|P63392|IRTA_MYCBO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtA PE=3 SV=1 1089 1348 4.0E-35
sp|P70864|NDVA_BARBA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis GN=ndvA PE=3 SV=2 325 651 5.0E-35
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 838 1344 7.0E-35
sp|P57551|MDLA_BUCAI Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlA PE=3 SV=1 792 1359 9.0E-35
sp|P47261|Y015_MYCGE Putative ABC transporter ATP-binding protein MG015 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG015 PE=3 SV=1 753 1348 1.0E-34
sp|P59653|COMA_STRR6 Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=comA PE=3 SV=1 93 652 1.0E-34
sp|Q6F9X0|MSBA_ACIAD Lipid A export ATP-binding/permease protein MsbA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=msbA PE=3 SV=1 1090 1341 2.0E-34
sp|Q00564|LCNC_LACLL Lactococcin-A transport/processing ATP-binding protein LcnC OS=Lactococcus lactis subsp. lactis GN=lcnC PE=3 SV=1 104 652 2.0E-34
sp|P0A2V1|NDVA_RHIRD Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium radiobacter GN=ndvA PE=1 SV=1 1089 1348 3.0E-34
sp|P0A2V0|NDVA_AGRFC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ndvA PE=3 SV=1 1089 1348 3.0E-34
sp|Q8T9W1|TAGD_DICDI Serine protease/ABC transporter B family protein tagD OS=Dictyostelium discoideum GN=tagD PE=3 SV=1 1090 1348 3.0E-34
sp|Q03727|COMA_STRPN Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=comA PE=3 SV=3 93 652 6.0E-34
sp|Q8G0T8|NDVA_BRUSU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella suis biovar 1 (strain 1330) GN=ndvA PE=3 SV=1 180 652 9.0E-34
sp|P59852|LAGD_LACLL Lactococcin-G-processing and transport ATP-binding protein LagD OS=Lactococcus lactis subsp. lactis GN=lagD PE=1 SV=1 77 652 9.0E-34
sp|Q0P9C4|PGLK_CAMJE Protein glycosylation K OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglK PE=1 SV=1 368 622 1.0E-33
sp|Q1QH37|NDVA_NITHX Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ndvA PE=3 SV=1 1083 1344 2.0E-33
sp|Q2K342|NDVA_RHIEC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ndvA PE=3 SV=2 1089 1348 2.0E-33
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 119 651 2.0E-33
sp|P36371|TAP2_MOUSE Antigen peptide transporter 2 OS=Mus musculus GN=Tap2 PE=1 SV=1 824 1340 2.0E-33
sp|P36372|TAP2_RAT Antigen peptide transporter 2 OS=Rattus norvegicus GN=Tap2 PE=2 SV=1 808 1340 3.0E-33
sp|Q71ED1|NDVA_AGRVI Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium vitis GN=ndvA PE=3 SV=1 1090 1348 3.0E-33
sp|Q8T9W1|TAGD_DICDI Serine protease/ABC transporter B family protein tagD OS=Dictyostelium discoideum GN=tagD PE=3 SV=1 371 649 3.0E-33
sp|Q6C6N0|ATM1_YARLI Iron-sulfur clusters transporter ATM1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATM1 PE=3 SV=1 812 1349 4.0E-33
sp|Q8YH20|NDVA_BRUME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ndvA PE=3 SV=1 180 652 4.0E-33
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 119 651 4.0E-33
sp|P54683|TAGB_DICDI Serine protease/ABC transporter B family protein tagB OS=Dictyostelium discoideum GN=tagB PE=3 SV=2 1090 1348 5.0E-33
sp|Q0P9C4|PGLK_CAMJE Protein glycosylation K OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglK PE=1 SV=1 1075 1332 5.0E-33
sp|P63398|Y1303_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1303c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1303c PE=3 SV=1 824 1348 7.0E-33
sp|P9WQJ3|Y1272_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1272c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1272c PE=1 SV=1 824 1348 7.0E-33
sp|P9WQJ2|Y1272_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1310 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1310 PE=3 SV=1 824 1348 7.0E-33
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 114 649 7.0E-33
sp|Q6BXD7|ATM1_DEBHA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATM1 PE=3 SV=2 1079 1341 7.0E-33
sp|P0C529|NDVA_BRUAB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus biovar 1 (strain 9-941) GN=ndvA PE=3 SV=1 180 652 7.0E-33
sp|Q2YQ73|NDVA_BRUA2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus (strain 2308) GN=ndvA PE=1 SV=1 180 652 7.0E-33
sp|Q8K984|MDLB_BUCAP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlB PE=3 SV=1 798 1344 8.0E-33
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 114 649 9.0E-33
sp|Q89A96|MDLB_BUCBP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlB PE=3 SV=1 370 655 1.0E-32
sp|O07550|YHEI_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI OS=Bacillus subtilis (strain 168) GN=yheI PE=1 SV=1 102 656 1.0E-32
sp|Q42093|AB2C_ARATH ABC transporter C family member 2 OS=Arabidopsis thaliana GN=ABCC2 PE=1 SV=2 380 1341 1.0E-32
sp|Q1MAB5|NDVA_RHIL3 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ndvA PE=3 SV=1 1089 1348 2.0E-32
sp|P0A4W5|Y1304_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1304c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1304c PE=3 SV=1 343 655 2.0E-32
sp|P9WQJ1|Y1273_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1273c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1273c PE=1 SV=1 343 655 2.0E-32
sp|P9WQJ0|Y1273_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1311 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1311 PE=3 SV=1 343 655 2.0E-32
sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 380 1344 2.0E-32
sp|Q5F4X8|MSBA_NEIG1 Lipid A export ATP-binding/permease protein MsbA OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=msbA PE=3 SV=1 794 1341 3.0E-32
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 41 656 6.0E-32
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 73 651 7.0E-32
sp|Q9JXR3|MSBA_NEIMB Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup B (strain MC58) GN=msbA PE=3 SV=1 794 1348 7.0E-32
sp|Q480N3|MSBA2_COLP3 Lipid A export ATP-binding/permease protein MsbA 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA2 PE=3 SV=2 797 1349 8.0E-32
sp|P18767|NDVA_RHIME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium meliloti (strain 1021) GN=ndvA PE=1 SV=2 1084 1348 8.0E-32
sp|Q03519|TAP2_HUMAN Antigen peptide transporter 2 OS=Homo sapiens GN=TAP2 PE=1 SV=1 813 1332 1.0E-31
sp|Q6CX96|ATM1_KLULA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATM1 PE=3 SV=1 812 1341 1.0E-31
sp|Q6FIK3|ATM1_CANGA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATM1 PE=3 SV=1 812 1344 1.0E-31
sp|Q12C33|MSBA_POLSJ Lipid A export ATP-binding/permease protein MsbA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msbA PE=3 SV=1 1090 1348 2.0E-31
sp|Q751N2|ATM1_ASHGO Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATM1 PE=3 SV=1 1088 1341 2.0E-31
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 73 651 2.0E-31
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 41 651 2.0E-31
sp|Q9C8G9|AB1C_ARATH ABC transporter C family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 380 1346 2.0E-31
sp|Q9CJB8|LCNCL_LACLA Lactococcin transport/processing ATP-binding protein LcnC-like OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lcnC PE=3 SV=1 104 652 2.0E-31
sp|Q9JW59|MSBA_NEIMA Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=msbA PE=3 SV=1 794 1348 3.0E-31
sp|Q57180|Y1051_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1051 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1051 PE=3 SV=1 1089 1356 4.0E-31
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 207 639 4.0E-31
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 207 639 5.0E-31
sp|Q9ZNB0|Y742_STRCO Uncharacterized ABC transporter ATP-binding protein SCO0742 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0742 PE=3 SV=1 119 653 5.0E-31
sp|O31708|YKNV_BACSU Uncharacterized ABC transporter ATP-binding protein YknV OS=Bacillus subtilis (strain 168) GN=yknV PE=3 SV=1 1089 1341 6.0E-31
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 73 651 7.0E-31
sp|Q3SP57|NDVA_NITWN Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ndvA PE=3 SV=2 1083 1341 1.0E-30
sp|Q59R09|ATM1_CANAL Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATM1 PE=3 SV=1 1089 1341 1.0E-30
sp|P9WQJ9|IRTA_MYCTU Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtA PE=1 SV=1 378 649 2.0E-30
sp|P9WQJ8|IRTA_MYCTO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtA PE=3 SV=1 378 649 2.0E-30
sp|P63392|IRTA_MYCBO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtA PE=3 SV=1 378 649 2.0E-30
sp|P36371|TAP2_MOUSE Antigen peptide transporter 2 OS=Mus musculus GN=Tap2 PE=1 SV=1 116 473 2.0E-30
sp|Q9CJB8|LCNCL_LACLA Lactococcin transport/processing ATP-binding protein LcnC-like OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lcnC PE=3 SV=1 837 1341 2.0E-30
sp|P39109|YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCF1 PE=1 SV=2 377 1334 2.0E-30
sp|P59852|LAGD_LACLL Lactococcin-G-processing and transport ATP-binding protein LagD OS=Lactococcus lactis subsp. lactis GN=lagD PE=1 SV=1 846 1349 3.0E-30
sp|Q57538|Y664_HAEIN Probable ABC transporter ATP-binding protein HI_0664 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0664 PE=1 SV=1 1090 1332 3.0E-30
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 129 655 3.0E-30
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 305 653 3.0E-30
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 305 653 3.0E-30
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 305 653 3.0E-30
sp|Q9ZNB0|Y742_STRCO Uncharacterized ABC transporter ATP-binding protein SCO0742 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0742 PE=3 SV=1 1089 1341 4.0E-30
sp|Q8K985|MDLA_BUCAP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlA PE=3 SV=1 112 655 6.0E-30
sp|Q983H5|NDVA_RHILO Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium loti (strain MAFF303099) GN=ndvA PE=3 SV=1 1090 1348 6.0E-30
sp|Q00564|LCNC_LACLL Lactococcin-A transport/processing ATP-binding protein LcnC OS=Lactococcus lactis subsp. lactis GN=lcnC PE=3 SV=1 837 1341 6.0E-30
sp|Q9C8H0|AB12C_ARATH ABC transporter C family member 12 OS=Arabidopsis thaliana GN=ABCC12 PE=2 SV=1 380 1344 1.0E-29
sp|Q10418|MESD_LEUME Mesentericin-Y105 transport/processing ATP-binding protein MesD OS=Leuconostoc mesenteroides GN=mesD PE=3 SV=1 112 649 1.0E-29
sp|P57552|MDLB_BUCAI Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlB PE=3 SV=1 371 654 2.0E-29
sp|P57552|MDLB_BUCAI Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlB PE=3 SV=1 1035 1349 2.0E-29
sp|P36497|PEDD_PEDAC Pediocin PA-1 transport/processing ATP-binding protein PedD OS=Pediococcus acidilactici GN=pedD PE=3 SV=1 838 1341 2.0E-29
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 391 1344 4.0E-29
sp|P36497|PEDD_PEDAC Pediocin PA-1 transport/processing ATP-binding protein PedD OS=Pediococcus acidilactici GN=pedD PE=3 SV=1 366 653 5.0E-29
sp|P0AAG5|MDLB_ECOLI Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli (strain K12) GN=mdlB PE=1 SV=1 802 1360 7.0E-29
sp|P0AAG6|MDLB_ECOL6 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdlB PE=3 SV=1 802 1360 7.0E-29
sp|P0AAG7|MDLB_ECO57 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O157:H7 GN=mdlB PE=3 SV=1 802 1360 7.0E-29
sp|Q10418|MESD_LEUME Mesentericin-Y105 transport/processing ATP-binding protein MesD OS=Leuconostoc mesenteroides GN=mesD PE=3 SV=1 813 1343 2.0E-28
sp|Q55DA7|ABCB7_DICDI ABC transporter B family member 7 OS=Dictyostelium discoideum GN=abcB7 PE=3 SV=1 821 1348 3.0E-28
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 841 1348 4.0E-28
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 841 1348 4.0E-28
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 841 1348 4.0E-28
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 38 651 7.0E-28
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 801 1341 7.0E-28
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 66 649 8.0E-28
sp|Q89A97|MDLA_BUCBP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlA PE=3 SV=1 874 1357 8.0E-28
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 801 1341 1.0E-27
sp|Q54NL1|ABCC9_DICDI ABC transporter C family member 9 OS=Dictyostelium discoideum GN=abcC9 PE=3 SV=1 776 1356 1.0E-27
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 1088 1348 2.0E-27
sp|P94367|CYDD_BACSU ATP-binding/permease protein CydD OS=Bacillus subtilis (strain 168) GN=cydD PE=3 SV=1 1088 1349 3.0E-27
sp|P33116|SPAT_BACIU Subtilin transport ATP-binding protein SpaT OS=Bacillus subtilis GN=spaT PE=3 SV=1 1089 1349 4.0E-27
sp|P47260|Y014_MYCGE Putative ABC transporter ATP-binding protein MG014 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG014 PE=3 SV=1 733 1349 8.0E-27
sp|Q8K984|MDLB_BUCAP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlB PE=3 SV=1 405 653 1.0E-26
sp|Q57538|Y664_HAEIN Probable ABC transporter ATP-binding protein HI_0664 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0664 PE=1 SV=1 310 615 1.0E-26
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 1107 1334 1.0E-26
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 847 1344 2.0E-26
sp|P59653|COMA_STRR6 Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=comA PE=3 SV=1 846 1341 3.0E-26
sp|Q54NL1|ABCC9_DICDI ABC transporter C family member 9 OS=Dictyostelium discoideum GN=abcC9 PE=3 SV=1 78 654 3.0E-26
sp|Q9P7V2|ABC4_SCHPO ATP-binding cassette transporter abc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc4 PE=3 SV=1 119 649 3.0E-26
sp|A7A063|NFT1_YEAS7 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NFT1 PE=3 SV=1 434 1332 5.0E-26
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 1102 1341 5.0E-26
sp|P57551|MDLA_BUCAI Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlA PE=3 SV=1 89 665 6.0E-26
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 119 651 7.0E-26
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 1080 1334 2.0E-25
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 370 653 3.0E-25
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 370 653 4.0E-25
sp|Q89A97|MDLA_BUCBP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlA PE=3 SV=1 110 627 7.0E-25
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 370 653 8.0E-25
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 78 651 1.0E-24
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 1102 1341 1.0E-24
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 370 655 1.0E-24
sp|P53049|YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR1 PE=1 SV=1 351 639 1.0E-24
sp|P91660|L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster GN=l(2)03659 PE=2 SV=3 120 640 1.0E-24
sp|Q03727|COMA_STRPN Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=comA PE=3 SV=3 846 1341 2.0E-24
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 370 653 2.0E-24
sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 75 627 2.0E-24
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 798 1344 3.0E-24
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 1107 1344 3.0E-24
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 1107 1334 3.0E-24
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 89 627 4.0E-24
sp|P45081|CYDC_HAEIN ATP-binding/permease protein CydC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydC PE=3 SV=1 329 640 5.0E-24
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 1107 1334 5.0E-24
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 375 646 6.0E-24
sp|P94367|CYDD_BACSU ATP-binding/permease protein CydD OS=Bacillus subtilis (strain 168) GN=cydD PE=3 SV=1 353 641 6.0E-24
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 93 655 7.0E-24
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 1107 1334 7.0E-24
sp|Q03024|APRD_PSEAE Alkaline protease secretion ATP-binding protein AprD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aprD PE=3 SV=1 1100 1332 7.0E-24
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 370 655 8.0E-24
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 1011 1344 8.0E-24
sp|A7A063|NFT1_YEAS7 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NFT1 PE=3 SV=1 371 627 8.0E-24
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 101 656 8.0E-24
sp|Q54K24|ABCCE_DICDI ABC transporter C family member 14 OS=Dictyostelium discoideum GN=abcC14 PE=3 SV=1 1069 1341 1.0E-23
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 1107 1344 2.0E-23
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 371 651 2.0E-23
sp|Q8T6H3|ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum GN=abcC6 PE=3 SV=1 1090 1341 2.0E-23
sp|P0CE69|YK104_YEAST Putative uncharacterized protein YKR104W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKR104W PE=5 SV=1 371 627 2.0E-23
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 47 627 2.0E-23
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 47 627 2.0E-23
sp|Q09428|ABCC8_HUMAN ATP-binding cassette sub-family C member 8 OS=Homo sapiens GN=ABCC8 PE=1 SV=6 189 1344 2.0E-23
sp|Q09428|ABCC8_HUMAN ATP-binding cassette sub-family C member 8 OS=Homo sapiens GN=ABCC8 PE=1 SV=6 69 652 2.0E-23
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 112 656 2.0E-23
sp|P33116|SPAT_BACIU Subtilin transport ATP-binding protein SpaT OS=Bacillus subtilis GN=spaT PE=3 SV=1 308 669 3.0E-23
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 1107 1334 3.0E-23
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 129 663 3.0E-23
sp|P23596|PRTD_DICCH Proteases secretion ATP-binding protein PrtD OS=Dickeya chrysanthemi GN=prtD PE=3 SV=1 1108 1347 3.0E-23
sp|Q10185|ABC2_SCHPO ATP-binding cassette transporter abc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc2 PE=1 SV=1 1107 1341 4.0E-23
sp|Q88XV1|ECFA2_LACPL Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=ecfA2 PE=3 SV=1 1088 1343 5.0E-23
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 101 646 6.0E-23
sp|Q2J220|PSTB_RHOP2 Phosphate import ATP-binding protein PstB OS=Rhodopseudomonas palustris (strain HaA2) GN=pstB PE=3 SV=1 354 613 7.0E-23
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 371 627 8.0E-23
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 371 627 8.0E-23
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 1090 1334 9.0E-23
sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 119 652 1.0E-22
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 1011 1344 1.0E-22
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 823 1332 1.0E-22
sp|Q8T6H3|ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum GN=abcC6 PE=3 SV=1 376 668 1.0E-22
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 47 627 1.0E-22
sp|Q9X2W0|MCJD_ECOLX Microcin-J25 export ATP-binding/permease protein McjD OS=Escherichia coli GN=mcjD PE=1 SV=1 1088 1341 1.0E-22
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 126 627 1.0E-22
sp|Q7NZI7|PSTB_CHRVO Phosphate import ATP-binding protein PstB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pstB PE=3 SV=1 365 635 1.0E-22
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 1100 1332 2.0E-22
sp|Q4JTG9|METN_CORJK Methionine import ATP-binding protein MetN OS=Corynebacterium jeikeium (strain K411) GN=metN PE=3 SV=1 1101 1341 2.0E-22
sp|Q7ANN4|PRSD_RHIME Type I secretion system ATP-binding protein PrsD OS=Rhizobium meliloti (strain 1021) GN=prsD PE=1 SV=2 1101 1341 2.0E-22
sp|Q1WSB9|ECFA2_LACS1 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactobacillus salivarius (strain UCC118) GN=ecfA2 PE=3 SV=1 1088 1341 2.0E-22
sp|Q09427|ABCC8_CRICR ATP-binding cassette sub-family C member 8 OS=Cricetus cricetus GN=ABCC8 PE=1 SV=3 110 652 2.0E-22
sp|Q09429|ABCC8_RAT ATP-binding cassette sub-family C member 8 OS=Rattus norvegicus GN=Abcc8 PE=1 SV=4 68 652 2.0E-22
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 1107 1344 3.0E-22
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 1090 1332 3.0E-22
sp|P71355|Y663_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0663 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0663 PE=3 SV=1 788 1355 3.0E-22
sp|Q0SVB6|PSTB_CLOPS Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain SM101 / Type A) GN=pstB PE=3 SV=1 366 625 4.0E-22
sp|Q8XMP8|PSTB_CLOPE Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain 13 / Type A) GN=pstB PE=3 SV=1 366 625 4.0E-22
sp|Q0TTG6|PSTB_CLOP1 Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=pstB PE=3 SV=1 366 625 4.0E-22
sp|Q54K24|ABCCE_DICDI ABC transporter C family member 14 OS=Dictyostelium discoideum GN=abcC14 PE=3 SV=1 370 654 5.0E-22
sp|P38735|VMR1_YEAST ABC transporter ATP-binding protein/permease VMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMR1 PE=2 SV=1 112 651 5.0E-22
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 1107 1337 5.0E-22
sp|P71355|Y663_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0663 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0663 PE=3 SV=1 372 653 6.0E-22
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 1090 1356 6.0E-22
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 101 655 7.0E-22
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 1108 1341 8.0E-22
sp|P91660|L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster GN=l(2)03659 PE=2 SV=3 1090 1346 9.0E-22
sp|Q09427|ABCC8_CRICR ATP-binding cassette sub-family C member 8 OS=Cricetus cricetus GN=ABCC8 PE=1 SV=3 189 1334 9.0E-22
sp|P38735|VMR1_YEAST ABC transporter ATP-binding protein/permease VMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMR1 PE=2 SV=1 1100 1351 9.0E-22
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 1090 1343 9.0E-22
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 370 627 1.0E-21
sp|Q4KC87|FBPC_PSEF5 Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=fbpC PE=3 SV=1 1089 1341 1.0E-21
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 1107 1337 1.0E-21
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 350 666 1.0E-21
sp|P22520|CVAB_ECOLX Colicin V secretion/processing ATP-binding protein CvaB OS=Escherichia coli GN=cvaB PE=3 SV=1 1097 1324 1.0E-21
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 371 632 2.0E-21
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 1107 1337 2.0E-21
sp|Q9EXN5|MCHF_ECOLX Probable microcin-H47 secretion/processing ATP-binding protein MchF OS=Escherichia coli GN=mchF PE=3 SV=1 1097 1324 2.0E-21
sp|Q88RL5|METN1_PSEPK Methionine import ATP-binding protein MetN 1 OS=Pseudomonas putida (strain KT2440) GN=metN1 PE=3 SV=1 379 639 2.0E-21
sp|Q9C9W0|AB17I_ARATH ABC transporter I family member 17 OS=Arabidopsis thaliana GN=ABCI17 PE=2 SV=1 1105 1342 2.0E-21
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 129 627 3.0E-21
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 371 632 3.0E-21
sp|P29018|CYDD_ECOLI ATP-binding/permease protein CydD OS=Escherichia coli (strain K12) GN=cydD PE=1 SV=3 394 650 3.0E-21
sp|Q5FT15|PSTB_GLUOX Phosphate import ATP-binding protein PstB OS=Gluconobacter oxydans (strain 621H) GN=pstB PE=3 SV=1 1104 1286 3.0E-21
sp|Q50294|ECFA1_MYCPN Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ecfA1 PE=3 SV=1 1089 1341 4.0E-21
sp|P75095|Y018_MYCPN Putative ABC transporter ATP-binding protein MG014 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_018 PE=3 SV=1 339 653 4.0E-21
sp|P39109|YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCF1 PE=1 SV=2 129 640 5.0E-21
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 1107 1332 7.0E-21
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 1107 1334 7.0E-21
sp|Q4FQD1|PSTB_PSYA2 Phosphate import ATP-binding protein PstB OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=pstB PE=3 SV=2 372 613 8.0E-21
sp|Q0D9V6|STAR1_ORYSJ Protein STAR1 OS=Oryza sativa subsp. japonica GN=STAR1 PE=1 SV=1 1106 1342 9.0E-21
sp|Q830W6|POTA_ENTFA Spermidine/putrescine import ATP-binding protein PotA OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=potA PE=3 SV=1 1090 1337 9.0E-21
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 1090 1344 1.0E-20
sp|Q9C9W0|AB17I_ARATH ABC transporter I family member 17 OS=Arabidopsis thaliana GN=ABCI17 PE=2 SV=1 389 639 1.0E-20
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 370 632 1.0E-20
sp|P68580|SUNT_BPSPB Sublancin-168-processing and transport ATP-binding protein sunT OS=Bacillus phage SPbeta GN=sunT PE=3 SV=1 1009 1336 1.0E-20
sp|P68579|SUNT_BACSU SPBc2 prophage-derived sublancin-168-processing and transport ATP-binding protein SunT OS=Bacillus subtilis (strain 168) GN=sunT PE=3 SV=1 1009 1336 1.0E-20
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 126 627 1.0E-20
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 99 664 2.0E-20
sp|P45081|CYDC_HAEIN ATP-binding/permease protein CydC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydC PE=3 SV=1 1090 1344 2.0E-20
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 371 632 2.0E-20
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 1089 1355 2.0E-20
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 1100 1341 2.0E-20
sp|Q5NN23|SSUB_ZYMMO Aliphatic sulfonates import ATP-binding protein SsuB OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ssuB PE=3 SV=1 1107 1350 2.0E-20
sp|Q9HS13|PSTB1_HALSA Phosphate import ATP-binding protein PstB 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pstB1 PE=3 SV=1 389 640 2.0E-20
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 1056 1356 2.0E-20
sp|Q1WSB8|ECFA1_LACS1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus salivarius (strain UCC118) GN=ecfA1 PE=3 SV=1 1087 1336 2.0E-20
sp|P94366|CYDC_BACSU ATP-binding/permease protein CydC OS=Bacillus subtilis (strain 168) GN=cydC PE=3 SV=1 410 653 2.0E-20
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 1090 1355 2.0E-20
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 1089 1334 3.0E-20
sp|Q52666|BZTD_RHOCB Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=bztD PE=3 SV=2 1086 1349 3.0E-20
sp|Q8R7Y5|ECFA2_CALS4 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=ecfA2 PE=1 SV=1 1088 1347 3.0E-20
sp|Q04EY4|ECFA3_OENOB Energy-coupling factor transporter ATP-binding protein EcfA3 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=ecfA3 PE=3 SV=1 1088 1341 3.0E-20
sp|Q6GJL2|METN1_STAAR Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain MRSA252) GN=metN1 PE=3 SV=1 382 639 4.0E-20
sp|Q8NY21|METN1_STAAW Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain MW2) GN=metN1 PE=3 SV=1 385 639 4.0E-20
sp|Q6GC27|METN1_STAAS Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain MSSA476) GN=metN1 PE=3 SV=1 385 639 4.0E-20
sp|Q7A7E3|METN1_STAAN Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain N315) GN=metN1 PE=3 SV=1 382 639 4.0E-20
sp|Q99WE1|METN1_STAAM Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=metN1 PE=3 SV=1 382 639 4.0E-20
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 1102 1341 4.0E-20
sp|Q1J6Q6|POTA_STRPF Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=potA PE=3 SV=1 1106 1337 4.0E-20
sp|Q1JGY7|POTA_STRPD Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=potA PE=3 SV=1 1106 1337 4.0E-20
sp|Q1JLT7|POTA_STRPC Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=potA PE=3 SV=1 1106 1337 4.0E-20
sp|Q1JBV6|POTA_STRPB Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=potA PE=3 SV=1 1106 1337 4.0E-20
sp|Q8FRX8|METN_COREF Methionine import ATP-binding protein MetN OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=metN PE=3 SV=1 1087 1341 4.0E-20
sp|Q9P7V2|ABC4_SCHPO ATP-binding cassette transporter abc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc4 PE=3 SV=1 1107 1349 5.0E-20
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 129 652 5.0E-20
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 1089 1348 5.0E-20
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 1087 1341 5.0E-20
sp|A0PXX8|ECFA2_CLONN Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium novyi (strain NT) GN=ecfA2 PE=3 SV=1 1088 1341 5.0E-20
sp|Q8DFC3|METN_VIBVU Methionine import ATP-binding protein MetN OS=Vibrio vulnificus (strain CMCP6) GN=metN PE=3 SV=1 382 639 5.0E-20
sp|Q12BB2|PSTB_POLSJ Phosphate import ATP-binding protein PstB OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=pstB PE=3 SV=1 391 612 5.0E-20
sp|Q7MN25|METN_VIBVY Methionine import ATP-binding protein MetN OS=Vibrio vulnificus (strain YJ016) GN=metN PE=3 SV=1 382 639 6.0E-20
sp|P0CZ35|POTA_STRPQ Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=potA PE=3 SV=1 1106 1337 6.0E-20
sp|Q48TP4|POTA_STRPM Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=potA PE=3 SV=1 1106 1337 6.0E-20
sp|Q5XCA4|POTA_STRP6 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=potA PE=3 SV=1 1106 1337 6.0E-20
sp|P0CZ34|POTA_STRP3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=potA PE=3 SV=1 1106 1337 6.0E-20
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 1100 1331 6.0E-20
sp|Q03203|NIST_LACLL Nisin transport ATP-binding protein NisT OS=Lactococcus lactis subsp. lactis GN=nisT PE=3 SV=1 1097 1350 6.0E-20
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 370 654 7.0E-20
sp|P94366|CYDC_BACSU ATP-binding/permease protein CydC OS=Bacillus subtilis (strain 168) GN=cydC PE=3 SV=1 1126 1360 7.0E-20
sp|Q9C8G9|AB1C_ARATH ABC transporter C family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 119 679 8.0E-20
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 325 652 8.0E-20
sp|Q9X2W0|MCJD_ECOLX Microcin-J25 export ATP-binding/permease protein McjD OS=Escherichia coli GN=mcjD PE=1 SV=1 304 640 9.0E-20
sp|P53049|YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR1 PE=1 SV=1 1073 1337 1.0E-19
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 847 1343 1.0E-19
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 346 654 1.0E-19
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 370 627 1.0E-19
sp|Q13W55|PSTB_BURXL Phosphate import ATP-binding protein PstB OS=Burkholderia xenovorans (strain LB400) GN=pstB PE=3 SV=1 359 613 1.0E-19
sp|Q0SBZ1|FBPC1_RHOJR Fe(3+) ions import ATP-binding protein FbpC 1 OS=Rhodococcus jostii (strain RHA1) GN=fbpC1 PE=3 SV=1 1105 1341 1.0E-19
sp|Q0S0Z3|FBPC2_RHOJR Fe(3+) ions import ATP-binding protein FbpC 2 OS=Rhodococcus jostii (strain RHA1) GN=fbpC2 PE=3 SV=1 1105 1341 1.0E-19
sp|Q8DZJ0|POTA_STRA5 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=potA PE=3 SV=1 1107 1337 1.0E-19
sp|Q8E554|POTA_STRA3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype III (strain NEM316) GN=potA PE=3 SV=1 1107 1337 1.0E-19
sp|Q3K0Y6|POTA_STRA1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=potA PE=3 SV=1 1107 1337 1.0E-19
sp|Q7VM95|METN_HAEDU Methionine import ATP-binding protein MetN OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=metN PE=3 SV=1 1108 1341 1.0E-19
sp|Q7CN92|POTA_STRP8 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=potA PE=3 SV=1 1106 1337 1.0E-19
sp|Q99ZS8|POTA_STRP1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M1 GN=potA PE=3 SV=1 1106 1337 1.0E-19
sp|Q5HIL5|METN1_STAAC Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain COL) GN=metN1 PE=3 SV=1 385 639 1.0E-19
sp|Q2G0V2|METN1_STAA8 Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=metN1 PE=3 SV=1 385 639 1.0E-19
sp|Q2FJI0|METN1_STAA3 Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain USA300) GN=metN1 PE=3 SV=1 385 639 1.0E-19
sp|Q87RS1|METN_VIBPA Methionine import ATP-binding protein MetN OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=metN PE=1 SV=1 382 639 1.0E-19
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 391 645 1.0E-19
sp|P47260|Y014_MYCGE Putative ABC transporter ATP-binding protein MG014 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG014 PE=3 SV=1 373 664 2.0E-19
sp|P23596|PRTD_DICCH Proteases secretion ATP-binding protein PrtD OS=Dickeya chrysanthemi GN=prtD PE=3 SV=1 338 629 2.0E-19
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 71 632 2.0E-19
sp|Q88RL5|METN1_PSEPK Methionine import ATP-binding protein MetN 1 OS=Pseudomonas putida (strain KT2440) GN=metN1 PE=3 SV=1 1090 1337 2.0E-19
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 105 655 2.0E-19
sp|Q7DM58|AB4C_ARATH ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=2 SV=2 1100 1331 2.0E-19
sp|Q52402|AARD_PROST Transport ATP-binding protein AarD OS=Providencia stuartii GN=aarD PE=3 SV=1 389 650 2.0E-19
sp|Q1IGZ0|METN2_PSEE4 Methionine import ATP-binding protein MetN 2 OS=Pseudomonas entomophila (strain L48) GN=metN2 PE=3 SV=1 379 639 2.0E-19
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 1107 1341 2.0E-19
sp|Q6F1W5|ECFA1_MESFL Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=ecfA1 PE=3 SV=1 373 640 2.0E-19
sp|P53706|HST6_CANAW Alpha-factor-transporting ATPase OS=Candida albicans (strain WO-1) GN=HST6 PE=3 SV=1 377 652 3.0E-19
sp|Q42093|AB2C_ARATH ABC transporter C family member 2 OS=Arabidopsis thaliana GN=ABCC2 PE=1 SV=2 119 652 3.0E-19
sp|Q9C8H0|AB12C_ARATH ABC transporter C family member 12 OS=Arabidopsis thaliana GN=ABCC12 PE=2 SV=1 119 640 3.0E-19
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 1107 1343 3.0E-19
sp|Q1WSB8|ECFA1_LACS1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus salivarius (strain UCC118) GN=ecfA1 PE=3 SV=1 366 634 3.0E-19
sp|Q8DFC3|METN_VIBVU Methionine import ATP-binding protein MetN OS=Vibrio vulnificus (strain CMCP6) GN=metN PE=3 SV=1 1099 1341 3.0E-19
sp|Q1GBJ0|ECFA1_LACDA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=ecfA1 PE=3 SV=1 1090 1346 3.0E-19
sp|Q221H2|PSTB_RHOFT Phosphate import ATP-binding protein PstB OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=pstB PE=3 SV=1 391 613 3.0E-19
sp|Q9JZW0|CYSA_NEIMB Sulfate/thiosulfate import ATP-binding protein CysA OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysA PE=3 SV=1 1106 1346 3.0E-19
sp|Q6D3Q6|METN2_PECAS Methionine import ATP-binding protein MetN 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN2 PE=3 SV=1 1094 1336 3.0E-19
sp|Q1Q8K4|PSTB_PSYCK Phosphate import ATP-binding protein PstB OS=Psychrobacter cryohalolentis (strain K5) GN=pstB PE=3 SV=2 377 612 3.0E-19
sp|Q8Y4E9|PSTB2_LISMO Phosphate import ATP-binding protein PstB 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pstB2 PE=3 SV=1 387 639 3.0E-19
sp|Q927Z7|PSTB2_LISIN Phosphate import ATP-binding protein PstB 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pstB2 PE=3 SV=1 387 639 3.0E-19
sp|Q9JUX4|CYSA_NEIMA Sulfate/thiosulfate import ATP-binding protein CysA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysA PE=3 SV=1 1106 1346 3.0E-19
sp|Q10185|ABC2_SCHPO ATP-binding cassette transporter abc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc2 PE=1 SV=1 119 656 4.0E-19
sp|Q7MN25|METN_VIBVY Methionine import ATP-binding protein MetN OS=Vibrio vulnificus (strain YJ016) GN=metN PE=3 SV=1 1099 1341 4.0E-19
sp|Q81J16|ECFA1_BACCR Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ecfA1 PE=3 SV=1 1093 1341 4.0E-19
sp|Q9A502|METN_CAUCR Methionine import ATP-binding protein MetN OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=metN PE=3 SV=1 391 616 4.0E-19
sp|Q04BY7|ECFA1_LACDB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=ecfA1 PE=3 SV=1 1090 1346 4.0E-19
sp|Q2YVT7|METN1_STAAB Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=metN1 PE=3 SV=1 382 639 4.0E-19
sp|Q8DPC2|POTA_STRR6 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=potA PE=3 SV=1 1107 1337 5.0E-19
sp|Q97Q42|POTA_STRPN Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=potA PE=3 SV=1 1107 1337 5.0E-19
sp|Q04JW0|POTA_STRP2 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=potA PE=3 SV=1 1107 1337 5.0E-19
sp|Q8Y454|ECFA1_LISMO Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=ecfA1 PE=3 SV=1 1090 1350 5.0E-19
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 371 654 6.0E-19
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 369 659 7.0E-19
sp|Q5HIL5|METN1_STAAC Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain COL) GN=metN1 PE=3 SV=1 1108 1341 7.0E-19
sp|Q2G0V2|METN1_STAA8 Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=metN1 PE=3 SV=1 1108 1341 7.0E-19
sp|Q2FJI0|METN1_STAA3 Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain USA300) GN=metN1 PE=3 SV=1 1108 1341 7.0E-19
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 1107 1341 9.0E-19
sp|Q6GJL2|METN1_STAAR Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain MRSA252) GN=metN1 PE=3 SV=1 1090 1341 9.0E-19
sp|Q8NY21|METN1_STAAW Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain MW2) GN=metN1 PE=3 SV=1 1108 1341 9.0E-19
sp|Q6GC27|METN1_STAAS Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain MSSA476) GN=metN1 PE=3 SV=1 1108 1341 9.0E-19
sp|Q1IGZ0|METN2_PSEE4 Methionine import ATP-binding protein MetN 2 OS=Pseudomonas entomophila (strain L48) GN=metN2 PE=3 SV=1 1090 1336 9.0E-19
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 1081 1344 1.0E-18
sp|Q9EXN5|MCHF_ECOLX Probable microcin-H47 secretion/processing ATP-binding protein MchF OS=Escherichia coli GN=mchF PE=3 SV=1 129 621 1.0E-18
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 71 632 2.0E-18
sp|Q7DM58|AB4C_ARATH ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=2 SV=2 369 659 2.0E-18
sp|Q1GBJ0|ECFA1_LACDA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=ecfA1 PE=3 SV=1 378 639 2.0E-18
sp|Q9A502|METN_CAUCR Methionine import ATP-binding protein MetN OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=metN PE=3 SV=1 1090 1331 2.0E-18
sp|Q04BY7|ECFA1_LACDB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=ecfA1 PE=3 SV=1 378 639 2.0E-18
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 1087 1341 3.0E-18
sp|Q7A7E3|METN1_STAAN Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain N315) GN=metN1 PE=3 SV=1 1090 1341 3.0E-18
sp|Q99WE1|METN1_STAAM Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=metN1 PE=3 SV=1 1090 1341 3.0E-18
sp|Q2YVT7|METN1_STAAB Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=metN1 PE=3 SV=1 1090 1341 4.0E-18
sp|P0CE69|YK104_YEAST Putative uncharacterized protein YKR104W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKR104W PE=5 SV=1 1108 1332 5.0E-18
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 1087 1341 5.0E-18
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 1107 1341 6.0E-18
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 1107 1341 6.0E-18
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 1090 1344 7.0E-18
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 1107 1337 1.0E-17
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 372 632 1.0E-17
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 1108 1341 1.0E-17
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 1083 1344 2.0E-17
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 213 665 2.0E-17
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 1107 1337 2.0E-17
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 1101 1348 2.0E-17
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 1087 1341 2.0E-17
sp|Q7NZI7|PSTB_CHRVO Phosphate import ATP-binding protein PstB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pstB PE=3 SV=1 1106 1337 2.0E-17
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 71 632 2.0E-17
sp|P22520|CVAB_ECOLX Colicin V secretion/processing ATP-binding protein CvaB OS=Escherichia coli GN=cvaB PE=3 SV=1 378 616 3.0E-17
sp|Q12BB2|PSTB_POLSJ Phosphate import ATP-binding protein PstB OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=pstB PE=3 SV=1 1089 1347 3.0E-17
sp|Q1Q8K4|PSTB_PSYCK Phosphate import ATP-binding protein PstB OS=Psychrobacter cryohalolentis (strain K5) GN=pstB PE=3 SV=2 1108 1351 3.0E-17
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 1107 1337 4.0E-17
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 1108 1332 4.0E-17
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 1108 1332 4.0E-17
sp|Q50294|ECFA1_MYCPN Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ecfA1 PE=3 SV=1 367 634 4.0E-17
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 1111 1341 4.0E-17
sp|Q4JTG9|METN_CORJK Methionine import ATP-binding protein MetN OS=Corynebacterium jeikeium (strain K411) GN=metN PE=3 SV=1 385 639 5.0E-17
sp|Q0D9V6|STAR1_ORYSJ Protein STAR1 OS=Oryza sativa subsp. japonica GN=STAR1 PE=1 SV=1 390 638 6.0E-17
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 213 661 7.0E-17
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 1101 1348 7.0E-17
sp|Q221H2|PSTB_RHOFT Phosphate import ATP-binding protein PstB OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=pstB PE=3 SV=1 1106 1316 7.0E-17
sp|P38735|VMR1_YEAST ABC transporter ATP-binding protein/permease VMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMR1 PE=2 SV=1 193 684 8.0E-17
sp|Q87RS1|METN_VIBPA Methionine import ATP-binding protein MetN OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=metN PE=1 SV=1 1099 1337 9.0E-17
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 1107 1337 1.0E-16
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 1107 1348 1.0E-16
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 347 652 1.0E-16
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 1089 1344 2.0E-16
sp|Q03203|NIST_LACLL Nisin transport ATP-binding protein NisT OS=Lactococcus lactis subsp. lactis GN=nisT PE=3 SV=1 371 640 2.0E-16
sp|Q13W55|PSTB_BURXL Phosphate import ATP-binding protein PstB OS=Burkholderia xenovorans (strain LB400) GN=pstB PE=3 SV=1 1106 1341 2.0E-16
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 1089 1344 3.0E-16
sp|Q4FQD1|PSTB_PSYA2 Phosphate import ATP-binding protein PstB OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=pstB PE=3 SV=2 1089 1353 3.0E-16
sp|Q7VM95|METN_HAEDU Methionine import ATP-binding protein MetN OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=metN PE=3 SV=1 391 640 3.0E-16
sp|Q52402|AARD_PROST Transport ATP-binding protein AarD OS=Providencia stuartii GN=aarD PE=3 SV=1 1121 1359 3.0E-16
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 391 639 4.0E-16
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 213 654 5.0E-16
sp|Q5FT15|PSTB_GLUOX Phosphate import ATP-binding protein PstB OS=Gluconobacter oxydans (strain 621H) GN=pstB PE=3 SV=1 350 613 5.0E-16
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 1085 1344 7.0E-16
sp|Q6F1W5|ECFA1_MESFL Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=ecfA1 PE=3 SV=1 1078 1349 8.0E-16
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 190 654 9.0E-16
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 1085 1344 1.0E-15
sp|Q03024|APRD_PSEAE Alkaline protease secretion ATP-binding protein AprD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aprD PE=3 SV=1 135 611 1.0E-15
sp|P29018|CYDD_ECOLI ATP-binding/permease protein CydD OS=Escherichia coli (strain K12) GN=cydD PE=1 SV=3 1103 1342 1.0E-15
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 1088 1344 1.0E-15
sp|Q8FRX8|METN_COREF Methionine import ATP-binding protein MetN OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=metN PE=3 SV=1 391 639 1.0E-15
sp|P36371|TAP2_MOUSE Antigen peptide transporter 2 OS=Mus musculus GN=Tap2 PE=1 SV=1 535 627 2.0E-15
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 391 684 2.0E-15
sp|Q0SVB6|PSTB_CLOPS Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain SM101 / Type A) GN=pstB PE=3 SV=1 1106 1334 2.0E-15
sp|Q8XMP8|PSTB_CLOPE Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain 13 / Type A) GN=pstB PE=3 SV=1 1106 1334 2.0E-15
sp|Q0TTG6|PSTB_CLOP1 Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=pstB PE=3 SV=1 1106 1334 2.0E-15
sp|Q9JZW0|CYSA_NEIMB Sulfate/thiosulfate import ATP-binding protein CysA OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysA PE=3 SV=1 391 593 2.0E-15
sp|Q9JUX4|CYSA_NEIMA Sulfate/thiosulfate import ATP-binding protein CysA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysA PE=3 SV=1 391 593 2.0E-15
sp|Q81J16|ECFA1_BACCR Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ecfA1 PE=3 SV=1 377 634 2.0E-15
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 370 627 4.0E-15
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 1108 1352 5.0E-15
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 1103 1355 5.0E-15
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 190 679 6.0E-15
sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 1107 1337 7.0E-15
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 1108 1349 8.0E-15
sp|Q8Y4E9|PSTB2_LISMO Phosphate import ATP-binding protein PstB 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pstB2 PE=3 SV=1 1106 1351 8.0E-15
sp|Q927Z7|PSTB2_LISIN Phosphate import ATP-binding protein PstB 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pstB2 PE=3 SV=1 1106 1351 8.0E-15
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 781 1343 9.0E-15
sp|Q42093|AB2C_ARATH ABC transporter C family member 2 OS=Arabidopsis thaliana GN=ABCC2 PE=1 SV=2 1089 1342 1.0E-14
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 1108 1349 1.0E-14
sp|P75095|Y018_MYCPN Putative ABC transporter ATP-binding protein MG014 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_018 PE=3 SV=1 1089 1348 1.0E-14
sp|Q6D3Q6|METN2_PECAS Methionine import ATP-binding protein MetN 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN2 PE=3 SV=1 372 635 1.0E-14
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 213 654 2.0E-14
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 1108 1349 3.0E-14
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 390 652 3.0E-14
sp|Q2J220|PSTB_RHOP2 Phosphate import ATP-binding protein PstB OS=Rhodopseudomonas palustris (strain HaA2) GN=pstB PE=3 SV=1 1108 1295 3.0E-14
sp|Q09429|ABCC8_RAT ATP-binding cassette sub-family C member 8 OS=Rattus norvegicus GN=Abcc8 PE=1 SV=4 1108 1348 3.0E-14
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 390 661 3.0E-14
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 391 676 4.0E-14
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 91 652 4.0E-14
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 1102 1344 4.0E-14
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 389 703 4.0E-14
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 1102 1344 4.0E-14
sp|Q8T6H3|ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum GN=abcC6 PE=3 SV=1 391 667 6.0E-14
sp|Q0SBZ1|FBPC1_RHOJR Fe(3+) ions import ATP-binding protein FbpC 1 OS=Rhodococcus jostii (strain RHA1) GN=fbpC1 PE=3 SV=1 368 608 6.0E-14
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 1089 1344 7.0E-14
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 1102 1354 8.0E-14
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 1105 1349 8.0E-14
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 389 680 8.0E-14
sp|P68580|SUNT_BPSPB Sublancin-168-processing and transport ATP-binding protein sunT OS=Bacillus phage SPbeta GN=sunT PE=3 SV=1 390 611 8.0E-14
sp|P68579|SUNT_BACSU SPBc2 prophage-derived sublancin-168-processing and transport ATP-binding protein SunT OS=Bacillus subtilis (strain 168) GN=sunT PE=3 SV=1 390 611 8.0E-14
sp|Q0S0Z3|FBPC2_RHOJR Fe(3+) ions import ATP-binding protein FbpC 2 OS=Rhodococcus jostii (strain RHA1) GN=fbpC2 PE=3 SV=1 368 608 9.0E-14
sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 997 1343 1.0E-13
sp|Q09427|ABCC8_CRICR ATP-binding cassette sub-family C member 8 OS=Cricetus cricetus GN=ABCC8 PE=1 SV=3 1108 1348 1.0E-13
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 389 703 1.0E-13
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 391 684 1.0E-13
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 349 687 2.0E-13
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 391 666 2.0E-13
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 391 684 2.0E-13
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 391 684 2.0E-13
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 368 651 2.0E-13
sp|Q09429|ABCC8_RAT ATP-binding cassette sub-family C member 8 OS=Rattus norvegicus GN=Abcc8 PE=1 SV=4 1185 1334 2.0E-13
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 1098 1341 2.0E-13
sp|Q9HS13|PSTB1_HALSA Phosphate import ATP-binding protein PstB 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pstB1 PE=3 SV=1 1108 1349 2.0E-13
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 369 698 2.0E-13
sp|Q7DM58|AB4C_ARATH ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=2 SV=2 373 951 2.0E-13
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 1089 1341 3.0E-13
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 390 652 3.0E-13
sp|Q8Y454|ECFA1_LISMO Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=ecfA1 PE=3 SV=1 370 657 3.0E-13
sp|A0PXX8|ECFA2_CLONN Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium novyi (strain NT) GN=ecfA2 PE=3 SV=1 373 632 4.0E-13
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 391 675 5.0E-13
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 1089 1341 6.0E-13
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 390 639 7.0E-13
sp|Q88XV1|ECFA2_LACPL Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=ecfA2 PE=3 SV=1 378 639 1.0E-12
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 390 681 1.0E-12
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 1089 1344 1.0E-12
sp|Q55DA7|ABCB7_DICDI ABC transporter B family member 7 OS=Dictyostelium discoideum GN=abcB7 PE=3 SV=1 114 639 2.0E-12
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 1105 1344 2.0E-12
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 1108 1344 3.0E-12
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 391 684 3.0E-12
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 1088 1344 3.0E-12
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 391 659 3.0E-12
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 391 650 5.0E-12
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 1105 1344 5.0E-12
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 1087 1344 6.0E-12
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 373 650 6.0E-12
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 370 681 7.0E-12
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 1107 1336 8.0E-12
sp|Q23868|TAGC_DICDI Serine protease/ABC transporter B family protein tagC OS=Dictyostelium discoideum GN=tagC PE=2 SV=2 726 1060 9.0E-12
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 391 706 1.0E-11
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 1108 1344 1.0E-11
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 383 650 2.0E-11
sp|Q8T6H3|ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum GN=abcC6 PE=3 SV=1 1108 1344 3.0E-11
sp|P38735|VMR1_YEAST ABC transporter ATP-binding protein/permease VMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMR1 PE=2 SV=1 816 1344 3.0E-11
sp|Q7ANN4|PRSD_RHIME Type I secretion system ATP-binding protein PrsD OS=Rhizobium meliloti (strain 1021) GN=prsD PE=1 SV=2 390 633 4.0E-11
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 1108 1341 5.0E-11
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 1102 1344 5.0E-11
sp|P91660|L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster GN=l(2)03659 PE=2 SV=3 1062 1343 6.0E-11
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 1108 1341 6.0E-11
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 1105 1344 7.0E-11
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 391 681 1.0E-10
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 391 684 1.0E-10
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 1062 1341 1.0E-10
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 841 1356 2.0E-10
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 391 652 2.0E-10
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 391 712 3.0E-10
sp|A7A063|NFT1_YEAS7 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NFT1 PE=3 SV=1 841 1356 3.0E-10
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 841 1356 4.0E-10
sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 1096 1341 5.0E-10
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 209 653 7.0E-10
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 391 655 9.0E-10
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 1186 1341 1.0E-09
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 1186 1341 1.0E-09
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 1108 1341 1.0E-09
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 330 665 1.0E-09
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 1108 1341 1.0E-09
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 1108 1341 1.0E-09
sp|Q8T9W1|TAGD_DICDI Serine protease/ABC transporter B family protein tagD OS=Dictyostelium discoideum GN=tagD PE=3 SV=1 737 1060 2.0E-09
sp|P39109|YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCF1 PE=1 SV=2 847 1343 2.0E-09
sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 382 653 2.0E-09
sp|Q54NL1|ABCC9_DICDI ABC transporter C family member 9 OS=Dictyostelium discoideum GN=abcC9 PE=3 SV=1 390 653 4.0E-09
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 1186 1341 5.0E-09
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 379 653 5.0E-09
sp|Q54NL1|ABCC9_DICDI ABC transporter C family member 9 OS=Dictyostelium discoideum GN=abcC9 PE=3 SV=1 1107 1341 7.0E-09
sp|Q09429|ABCC8_RAT ATP-binding cassette sub-family C member 8 OS=Rattus norvegicus GN=Abcc8 PE=1 SV=4 189 627 7.0E-09
sp|Q04EY4|ECFA3_OENOB Energy-coupling factor transporter ATP-binding protein EcfA3 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=ecfA3 PE=3 SV=1 377 639 9.0E-09
sp|Q9P7V2|ABC4_SCHPO ATP-binding cassette transporter abc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc4 PE=3 SV=1 383 628 2.0E-08
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 536 653 2.0E-08
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 75 640 2.0E-08
sp|Q52666|BZTD_RHOCB Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=bztD PE=3 SV=2 553 635 2.0E-08
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 536 705 3.0E-08
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 536 705 3.0E-08
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 849 1336 4.0E-08
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 192 680 4.0E-08
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 192 680 5.0E-08
sp|P53049|YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR1 PE=1 SV=1 521 667 1.0E-07
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 391 687 1.0E-07
sp|Q5NN23|SSUB_ZYMMO Aliphatic sulfonates import ATP-binding protein SsuB OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ssuB PE=3 SV=1 554 613 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0005524 ATP binding Yes
GO:0016021 integral component of membrane Yes
GO:0140359 ABC-type transporter activity Yes
GO:0006810 transport No
GO:0032555 purine ribonucleotide binding No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0043167 ion binding No
GO:0051179 localization No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No
GO:0031224 intrinsic component of membrane No
GO:0140657 ATP-dependent activity No
GO:0022804 active transmembrane transporter activity No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0022857 transmembrane transporter activity No
GO:0005488 binding No
GO:0009987 cellular process No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0005575 cellular_component No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 37 59 22
2 91 113 22
3 188 210 22
4 266 288 22
5 309 331 22
6 747 769 22
7 789 811 22
8 865 887 22
9 894 916 22
10 974 996 22
11 1009 1031 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5162
MASPRQASSASRDPGLAVVAGFLRLLTAAEPAPLDYVLLLVGTFGSILAGLPFPVMFVIFGELLDQVNTASCSDE
PVSESYYQSLSTKVLLTVCVAIANFVSIYVSAGAWSLFGERLVRRLRYSYLCVLLRQDIAFFESLSAGDVAARLD
SDLLTIQTGVSEKVGIVIQSVAYFVAAYCVSFVKDARLAAMLISLVPAFFFMTFIGTHLSGKYRVAVEKSIEPAN
ALASESLANIKLVKALHAGKRVQAIFDGYLDAARQPAIAKLATAAIQMGLLHFIAYSANALAFSQGGKHIADAKE
AGDMGVTAGAVYTVMVTLIDASYILSQVAPFLNMFGAASQTAAKMLATIERKPAIDASPTASGLVMSTFEGHVEL
IDVSFRYPSRPDIRILDKLNLTICAGKTTAIVGLSGSGKSTVASLIQRFYDVDEGAVVVDGHDVRDVNLHALRGH
VGYVEQNPMLFNRSILENIAHGLVGSSRPEHRILRPSLINGDLAELVEAVRSGGDLDALAARSAVLFRILSLVRV
AATQAGSDGFLDSFPYGLATSAGPAGSRLSGGQRQRIALARALIRNPSMLILDEATAALDSATEAQIQEIIANLP
GKRTILCIAHRLSTVRDAHTIFVTGPGGQVLEQGNYGELMGIGGVFASMVRSQAILGDGQDDRNTEKTATRTSND
DQDPEKTMELLPWVPQKQPDVASNNGKVSTRPRGDEHGATCLDSRYNRAEREKSFSATFALMLRMIRPQLLLVVV
GSLCSIVIGGSHAGDAVIFGNGVGHLSVCRTASQVRRSAALYGLLYFILAVVEFFAHSVSVACFGWVSDQLVRQL
RSLTLQSLLKRQVPWHESDGRTPGTLMSLLSADAAAMSGLTGTILGACVSVLVTLVAGIVLAHVVAWKVAVVLTA
CVPLIFGAGFLRIRLFAKFAERHAKAFAESVSTAAESVSHIRTVSAFALQDEVAGTFGRALKGPYNATLRSITFG
TVWLAAAFSLGSLVKALAFYWGGRLIAEREITQTSLFITLVSLLSAAQLSGQMFSLSPDISKAAVASRRVFGLIF
SGGPTNRLNLGGSADGEKGALAMTEGGSLGSTGRGMGMSVSFKSVWFSYPGQPEAHILRDVSVDIPAGAFVALVG
ASGAGKSTMLSLLQRLYRPQAGTIRLDGYDVTGRTSNKERDDEDGDDDGDDDTWPFWDDVAFVPQDATLFSGSVA
FNIGLGGRGTETVTMAEMEAAARLANIHETIISLPEGYDTSCGPTGSQLFSGGQKQRLCIARALVRRPRLLLLDE
PSSAMDAESEALWETSLESIIQAGEDGRGRVTVIGIAHRLRTIMKADRIFVMDGGRIVDAGTHRELTRRCERYRD
DVMHQTLELA
Coding >Ophio5|5162
ATGGCCTCGCCCCGGCAGGCTTCGTCTGCCTCCAGGGATCCGGGCCTTGCTGTTGTCGCTGGCTTCCTTCGCCTC
CTGACGGCGGCCGAGCCGGCGCCTCTCGACTATGTGCTGCTCCTGGTCGGGACCTTTGGTTCCATCCTGGCTGGC
TTGCCTTTTCCTGTCATGTTCGTCATCTTCGGCGAGCTGCTCGACCAGGTGAACACGGCTTCGTGCTCCGATGAG
CCCGTCTCCGAGTCCTACTACCAGTCGCTCTCGACCAAGGTTCTCCTGACTGTCTGCGTCGCAATCGCCAATTTT
GTCTCCATCTACGTTTCCGCTGGCGCTTGGAGTCTCTTCGGCGAGCGTCTTGTGCGCCGTCTGCGCTATAGCTAT
CTCTGTGTTCTCCTGCGCCAGGACATTGCCTTCTTCGAGTCTCTGTCCGCCGGCGATGTGGCTGCCCGTCTCGAC
TCCGACCTGCTTACCATCCAGACGGGCGTCTCGGAGAAGGTCGGCATCGTCATCCAGTCTGTCGCCTACTTCGTC
GCTGCCTACTGTGTCAGTTTCGTCAAGGATGCCAGACTCGCTGCCATGCTCATCAGCCTCGTGCCGGCCTTCTTC
TTCATGACCTTTATCGGCACCCATCTCTCAGGCAAGTACAGAGTCGCCGTTGAGAAGAGCATAGAGCCCGCCAAT
GCTCTGGCCTCCGAGTCCCTGGCCAATATCAAGCTTGTCAAGGCCTTGCACGCTGGCAAGAGAGTTCAGGCCATC
TTTGACGGCTATCTGGATGCCGCGCGGCAACCCGCAATCGCAAAGCTGGCGACAGCCGCCATTCAGATGGGCTTG
CTGCACTTTATCGCATACTCGGCAAACGCACTGGCCTTCTCCCAGGGCGGTAAACACATCGCCGACGCCAAGGAA
GCCGGTGACATGGGAGTGACCGCCGGTGCCGTCTATACTGTCATGGTCACTCTTATTGACGCCTCATACATTCTC
AGTCAAGTCGCCCCTTTCCTCAACATGTTCGGGGCAGCATCGCAGACGGCGGCCAAGATGCTTGCCACCATTGAG
CGGAAGCCAGCCATTGATGCCTCCCCTACCGCCTCAGGTCTGGTCATGTCAACATTCGAGGGTCACGTCGAGCTG
ATAGACGTTTCATTCCGATATCCGTCACGTCCAGACATACGCATCCTCGACAAGCTCAATCTCACCATTTGTGCT
GGGAAGACGACGGCTATAGTTGGTCTCTCGGGAAGCGGCAAGTCTACCGTTGCTTCGCTCATTCAACGGTTTTAC
GACGTTGACGAGGGCGCCGTCGTAGTCGACGGGCATGATGTGCGCGACGTCAACTTACACGCTCTCCGAGGTCAT
GTTGGCTATGTCGAGCAAAATCCCATGCTGTTCAATCGCTCGATTCTGGAAAACATTGCTCACGGTTTGGTTGGC
TCCTCTCGGCCGGAGCACCGGATATTGCGGCCCTCGTTGATTAATGGCGATTTGGCCGAGCTGGTCGAGGCTGTA
CGCAGTGGCGGTGATTTGGATGCACTGGCGGCGCGTTCGGCTGTGCTGTTCCGTATTCTCTCCCTTGTCCGAGTG
GCAGCCACGCAGGCCGGCTCGGATGGCTTCCTCGATAGCTTTCCTTACGGCCTTGCCACGTCTGCTGGTCCAGCT
GGCAGCCGTCTGAGCGGCGGCCAGAGGCAACGTATTGCCCTCGCCCGCGCCTTGATCCGAAATCCATCGATGCTG
ATTCTGGACGAGGCCACTGCTGCACTGGATTCGGCTACCGAAGCCCAAATCCAAGAAATCATCGCCAATCTCCCA
GGCAAGCGCACAATCCTTTGCATTGCCCATCGTCTGAGCACCGTTAGAGACGCCCACACAATCTTCGTGACGGGT
CCAGGCGGGCAGGTTCTTGAGCAAGGGAATTACGGGGAGTTGATGGGTATCGGCGGCGTCTTTGCGTCCATGGTT
CGCTCACAGGCCATTCTTGGGGACGGCCAGGACGACCGGAACACGGAGAAGACGGCGACAAGAACATCCAACGAT
GATCAGGATCCGGAAAAGACGATGGAGTTGTTGCCCTGGGTACCTCAAAAGCAGCCCGACGTTGCGTCAAATAAC
GGCAAGGTTTCCACGAGACCTCGGGGCGACGAACACGGGGCGACATGTCTCGACTCCCGCTACAACCGAGCCGAG
AGGGAGAAAAGCTTCTCTGCCACGTTCGCGCTAATGCTCAGGATGATACGCCCGCAGTTGCTACTCGTCGTCGTC
GGATCATTATGCTCCATCGTCATCGGCGGCTCTCACGCGGGAGATGCCGTCATCTTTGGCAACGGGGTTGGGCAC
TTGTCCGTCTGTCGTACGGCTTCTCAAGTGCGGAGAAGCGCCGCCCTCTACGGGCTTCTGTACTTTATCCTGGCC
GTCGTCGAGTTCTTCGCCCATTCGGTTTCGGTCGCGTGTTTTGGCTGGGTATCCGATCAGCTGGTTCGTCAGTTA
CGCTCGTTGACGCTGCAATCGTTGCTCAAGCGACAAGTACCATGGCACGAGTCTGACGGCCGGACCCCGGGCACC
TTGATGTCGCTCCTGAGCGCGGATGCCGCAGCCATGAGCGGGCTCACGGGCACGATCCTGGGCGCCTGTGTTTCT
GTTCTCGTCACGCTGGTGGCCGGCATCGTCCTTGCCCATGTGGTTGCATGGAAGGTGGCGGTGGTGCTCACGGCT
TGTGTCCCCCTCATCTTCGGCGCCGGGTTTCTTCGGATCCGTCTCTTTGCCAAGTTCGCCGAGCGGCACGCAAAG
GCATTTGCCGAGTCGGTCAGTACGGCCGCCGAGTCCGTCAGCCATATACGGACCGTATCGGCGTTTGCGCTCCAG
GACGAGGTGGCCGGCACCTTTGGCAGGGCGTTGAAGGGTCCGTACAACGCCACGCTCAGGTCCATCACCTTTGGA
ACTGTTTGGCTCGCGGCGGCCTTTAGTCTCGGCAGCCTGGTCAAGGCCCTGGCGTTTTATTGGGGAGGCCGGCTT
ATTGCCGAGCGCGAGATCACCCAAACGTCCTTGTTCATCACCTTGGTCTCCTTGCTATCGGCCGCGCAGTTGAGC
GGGCAGATGTTTAGCCTCAGCCCGGATATCTCCAAGGCTGCTGTGGCTTCGCGTCGCGTATTTGGCCTCATCTTC
TCCGGCGGGCCGACGAACAGGTTGAACCTTGGGGGTTCGGCCGATGGCGAGAAGGGAGCATTGGCGATGACAGAG
GGGGGTTCGCTTGGGTCAACGGGACGAGGCATGGGCATGTCTGTGTCTTTCAAAAGTGTCTGGTTTTCATATCCG
GGCCAGCCTGAGGCGCACATTCTTCGCGATGTCTCCGTCGATATTCCAGCGGGCGCCTTTGTCGCCCTCGTGGGG
GCCAGCGGAGCAGGAAAGTCGACGATGCTTTCGCTATTACAGCGCCTATATAGGCCCCAGGCGGGAACCATCAGG
CTCGACGGGTACGACGTCACGGGCCGCACTTCGAACAAGGAGAGGGACGACGAGGATGGTGACGACGATGGTGAC
GACGACACATGGCCATTCTGGGACGATGTGGCATTTGTGCCGCAAGATGCTACCCTGTTCTCGGGAAGCGTCGCC
TTTAACATTGGCCTCGGTGGCCGAGGCACTGAGACCGTGACTATGGCCGAAATGGAGGCGGCGGCGCGGCTGGCC
AACATACATGAGACAATCATCAGCCTCCCGGAAGGCTACGACACGTCTTGCGGGCCAACGGGCTCACAGCTTTTC
TCCGGGGGCCAGAAGCAGCGATTGTGCATTGCGCGTGCTTTGGTACGAAGACCACGTCTACTGCTTCTCGACGAG
CCCAGCAGCGCCATGGACGCAGAGAGCGAGGCGCTGTGGGAGACGTCGCTCGAGAGCATCATCCAGGCGGGCGAG
GACGGCCGGGGGAGGGTGACGGTCATTGGAATCGCCCACCGGCTGCGGACGATCATGAAGGCCGACAGGATATTC
GTCATGGACGGCGGCCGGATCGTGGACGCGGGGACGCACAGGGAGTTGACTCGGCGATGCGAGCGATATCGCGAC
GACGTGATGCACCAGACTTTAGAGTTAGCG
Transcript >Ophio5|5162
ATGGCCTCGCCCCGGCAGGCTTCGTCTGCCTCCAGGGATCCGGGCCTTGCTGTTGTCGCTGGCTTCCTTCGCCTC
CTGACGGCGGCCGAGCCGGCGCCTCTCGACTATGTGCTGCTCCTGGTCGGGACCTTTGGTTCCATCCTGGCTGGC
TTGCCTTTTCCTGTCATGTTCGTCATCTTCGGCGAGCTGCTCGACCAGGTGAACACGGCTTCGTGCTCCGATGAG
CCCGTCTCCGAGTCCTACTACCAGTCGCTCTCGACCAAGGTTCTCCTGACTGTCTGCGTCGCAATCGCCAATTTT
GTCTCCATCTACGTTTCCGCTGGCGCTTGGAGTCTCTTCGGCGAGCGTCTTGTGCGCCGTCTGCGCTATAGCTAT
CTCTGTGTTCTCCTGCGCCAGGACATTGCCTTCTTCGAGTCTCTGTCCGCCGGCGATGTGGCTGCCCGTCTCGAC
TCCGACCTGCTTACCATCCAGACGGGCGTCTCGGAGAAGGTCGGCATCGTCATCCAGTCTGTCGCCTACTTCGTC
GCTGCCTACTGTGTCAGTTTCGTCAAGGATGCCAGACTCGCTGCCATGCTCATCAGCCTCGTGCCGGCCTTCTTC
TTCATGACCTTTATCGGCACCCATCTCTCAGGCAAGTACAGAGTCGCCGTTGAGAAGAGCATAGAGCCCGCCAAT
GCTCTGGCCTCCGAGTCCCTGGCCAATATCAAGCTTGTCAAGGCCTTGCACGCTGGCAAGAGAGTTCAGGCCATC
TTTGACGGCTATCTGGATGCCGCGCGGCAACCCGCAATCGCAAAGCTGGCGACAGCCGCCATTCAGATGGGCTTG
CTGCACTTTATCGCATACTCGGCAAACGCACTGGCCTTCTCCCAGGGCGGTAAACACATCGCCGACGCCAAGGAA
GCCGGTGACATGGGAGTGACCGCCGGTGCCGTCTATACTGTCATGGTCACTCTTATTGACGCCTCATACATTCTC
AGTCAAGTCGCCCCTTTCCTCAACATGTTCGGGGCAGCATCGCAGACGGCGGCCAAGATGCTTGCCACCATTGAG
CGGAAGCCAGCCATTGATGCCTCCCCTACCGCCTCAGGTCTGGTCATGTCAACATTCGAGGGTCACGTCGAGCTG
ATAGACGTTTCATTCCGATATCCGTCACGTCCAGACATACGCATCCTCGACAAGCTCAATCTCACCATTTGTGCT
GGGAAGACGACGGCTATAGTTGGTCTCTCGGGAAGCGGCAAGTCTACCGTTGCTTCGCTCATTCAACGGTTTTAC
GACGTTGACGAGGGCGCCGTCGTAGTCGACGGGCATGATGTGCGCGACGTCAACTTACACGCTCTCCGAGGTCAT
GTTGGCTATGTCGAGCAAAATCCCATGCTGTTCAATCGCTCGATTCTGGAAAACATTGCTCACGGTTTGGTTGGC
TCCTCTCGGCCGGAGCACCGGATATTGCGGCCCTCGTTGATTAATGGCGATTTGGCCGAGCTGGTCGAGGCTGTA
CGCAGTGGCGGTGATTTGGATGCACTGGCGGCGCGTTCGGCTGTGCTGTTCCGTATTCTCTCCCTTGTCCGAGTG
GCAGCCACGCAGGCCGGCTCGGATGGCTTCCTCGATAGCTTTCCTTACGGCCTTGCCACGTCTGCTGGTCCAGCT
GGCAGCCGTCTGAGCGGCGGCCAGAGGCAACGTATTGCCCTCGCCCGCGCCTTGATCCGAAATCCATCGATGCTG
ATTCTGGACGAGGCCACTGCTGCACTGGATTCGGCTACCGAAGCCCAAATCCAAGAAATCATCGCCAATCTCCCA
GGCAAGCGCACAATCCTTTGCATTGCCCATCGTCTGAGCACCGTTAGAGACGCCCACACAATCTTCGTGACGGGT
CCAGGCGGGCAGGTTCTTGAGCAAGGGAATTACGGGGAGTTGATGGGTATCGGCGGCGTCTTTGCGTCCATGGTT
CGCTCACAGGCCATTCTTGGGGACGGCCAGGACGACCGGAACACGGAGAAGACGGCGACAAGAACATCCAACGAT
GATCAGGATCCGGAAAAGACGATGGAGTTGTTGCCCTGGGTACCTCAAAAGCAGCCCGACGTTGCGTCAAATAAC
GGCAAGGTTTCCACGAGACCTCGGGGCGACGAACACGGGGCGACATGTCTCGACTCCCGCTACAACCGAGCCGAG
AGGGAGAAAAGCTTCTCTGCCACGTTCGCGCTAATGCTCAGGATGATACGCCCGCAGTTGCTACTCGTCGTCGTC
GGATCATTATGCTCCATCGTCATCGGCGGCTCTCACGCGGGAGATGCCGTCATCTTTGGCAACGGGGTTGGGCAC
TTGTCCGTCTGTCGTACGGCTTCTCAAGTGCGGAGAAGCGCCGCCCTCTACGGGCTTCTGTACTTTATCCTGGCC
GTCGTCGAGTTCTTCGCCCATTCGGTTTCGGTCGCGTGTTTTGGCTGGGTATCCGATCAGCTGGTTCGTCAGTTA
CGCTCGTTGACGCTGCAATCGTTGCTCAAGCGACAAGTACCATGGCACGAGTCTGACGGCCGGACCCCGGGCACC
TTGATGTCGCTCCTGAGCGCGGATGCCGCAGCCATGAGCGGGCTCACGGGCACGATCCTGGGCGCCTGTGTTTCT
GTTCTCGTCACGCTGGTGGCCGGCATCGTCCTTGCCCATGTGGTTGCATGGAAGGTGGCGGTGGTGCTCACGGCT
TGTGTCCCCCTCATCTTCGGCGCCGGGTTTCTTCGGATCCGTCTCTTTGCCAAGTTCGCCGAGCGGCACGCAAAG
GCATTTGCCGAGTCGGTCAGTACGGCCGCCGAGTCCGTCAGCCATATACGGACCGTATCGGCGTTTGCGCTCCAG
GACGAGGTGGCCGGCACCTTTGGCAGGGCGTTGAAGGGTCCGTACAACGCCACGCTCAGGTCCATCACCTTTGGA
ACTGTTTGGCTCGCGGCGGCCTTTAGTCTCGGCAGCCTGGTCAAGGCCCTGGCGTTTTATTGGGGAGGCCGGCTT
ATTGCCGAGCGCGAGATCACCCAAACGTCCTTGTTCATCACCTTGGTCTCCTTGCTATCGGCCGCGCAGTTGAGC
GGGCAGATGTTTAGCCTCAGCCCGGATATCTCCAAGGCTGCTGTGGCTTCGCGTCGCGTATTTGGCCTCATCTTC
TCCGGCGGGCCGACGAACAGGTTGAACCTTGGGGGTTCGGCCGATGGCGAGAAGGGAGCATTGGCGATGACAGAG
GGGGGTTCGCTTGGGTCAACGGGACGAGGCATGGGCATGTCTGTGTCTTTCAAAAGTGTCTGGTTTTCATATCCG
GGCCAGCCTGAGGCGCACATTCTTCGCGATGTCTCCGTCGATATTCCAGCGGGCGCCTTTGTCGCCCTCGTGGGG
GCCAGCGGAGCAGGAAAGTCGACGATGCTTTCGCTATTACAGCGCCTATATAGGCCCCAGGCGGGAACCATCAGG
CTCGACGGGTACGACGTCACGGGCCGCACTTCGAACAAGGAGAGGGACGACGAGGATGGTGACGACGATGGTGAC
GACGACACATGGCCATTCTGGGACGATGTGGCATTTGTGCCGCAAGATGCTACCCTGTTCTCGGGAAGCGTCGCC
TTTAACATTGGCCTCGGTGGCCGAGGCACTGAGACCGTGACTATGGCCGAAATGGAGGCGGCGGCGCGGCTGGCC
AACATACATGAGACAATCATCAGCCTCCCGGAAGGCTACGACACGTCTTGCGGGCCAACGGGCTCACAGCTTTTC
TCCGGGGGCCAGAAGCAGCGATTGTGCATTGCGCGTGCTTTGGTACGAAGACCACGTCTACTGCTTCTCGACGAG
CCCAGCAGCGCCATGGACGCAGAGAGCGAGGCGCTGTGGGAGACGTCGCTCGAGAGCATCATCCAGGCGGGCGAG
GACGGCCGGGGGAGGGTGACGGTCATTGGAATCGCCCACCGGCTGCGGACGATCATGAAGGCCGACAGGATATTC
GTCATGGACGGCGGCCGGATCGTGGACGCGGGGACGCACAGGGAGTTGACTCGGCGATGCGAGCGATATCGCGAC
GACGTGATGCACCAGACTTTAGAGTTAGCGTAG
Gene >Ophio5|5162
ATGGCCTCGCCCCGGCAGGCTTCGTCTGCCTCCAGGGATCCGGGCCTTGCTGTTGTCGCTGGCTTCCTTCGCCTC
CTGACGGCGGCCGAGCCGGCGCCTCTCGACTATGTGCTGCTCCTGGTCGGGACCTTTGGTTCCATCCTGGCTGGC
TTGCCTTTTCCTGTCATGTTCGTCATCTTCGGCGAGCTGCTCGACCAGGTGAACACGGCTTCGTGCTCCGATGAG
CCCGTCTCCGAGTCCTACTACCAGTCGCTCTCGACCAAGGTTCTCCTGACTGTCTGCGTCGCAATCGCCAATTTT
GTCTCCATCTACGTTTCCGCTGGCGCTTGGAGTCTCTTCGGCGAGCGTCTTGTGCGCCGTCTGCGCTATAGCTAT
CTCTGTGTTCTCCTGCGCCAGGACATTGCCTTCTTCGAGTCTCTGTCCGCCGGCGATGTGGCTGCCCGTCTCGAC
TCCGACCTGCTTACCATCCAGACGGGCGTCTCGGAGAAGGTCGGCATCGTCATCCAGTCTGTCGCCTACTTCGTC
GCTGCCTACTGTGTCAGTTTCGTCAAGGATGCCAGACTCGCTGCCATGCTCATCAGCCTCGTGCCGGCCTTCTTC
TTCATGACCTTTATCGGCACCCATCTCTCAGGCAAGTACAGAGTCGCCGTTGAGAAGAGCATAGAGCCCGCCAAT
GCTCTGGCCTCCGAGTCCCTGGCCAATATCAAGCTTGTCAAGGCCTTGCACGCTGGCAAGAGAGTTCAGGCCATC
TTTGACGGCTATCTGGATGCCGCGCGGCAACCCGCAATCGCAAAGCTGGCGACAGCCGCCATTCAGATGGGCTTG
CTGCACTTTATCGCATACTCGGCAAACGCACTGGCCTTCTCCCAGGGCGGTAAACACATCGCCGACGCCAAGGAA
GCCGGTGACATGGGAGTGACCGCCGGTGCCGTCTATACTGTCATGGTCACTCTTATTGACGGTATGACTGCGTGT
CGCCCCCTGCCTCGTCTATCCGCCCACGCTTACTGGCACATTCTCCCACTTCTGCAGCCTCATACATTCTCAGTC
AAGTCGCCCCTTTCCTCAACATGTTCGGGGCAGCATCGCAGACGGCGGCCAAGATGCTTGCCACCATTGAGCGGA
AGCCAGCCATTGATGCCTCCCCTACCGCCTCAGGTCTGGTCATGTCAACATTCGAGGGTCACGTCGAGCTGATAG
ACGTTTCATTCCGATATCCGTCACGTCCAGACATACGCATCCTCGACAAGCTCAATCTCACCATTTGTGCTGGGA
AGACGACGGCTATAGTTGGTCTCTCGGGAAGCGGCAAGTCTACCGTTGCTTCGCTCATTCAACGGTTTTACGACG
TTGACGAGGGCGCCGTCGTAGTCGACGGGCATGATGTGCGCGACGTCAACTTACACGCTCTCCGAGGTCATGTTG
GCTATGTCGAGCAAAATCCCATGCTGTTCAATCGCTCGATTCTGGAAAACATTGCTCACGGTTTGGTTGGCTCCT
CTCGGCCGGAGCACCGGATATTGCGGCCCTCGTTGATTAATGGCGATTTGGCCGAGCTGGTCGAGGCTGTACGCA
GTGGCGGTGATTTGGATGCACTGGCGGCGCGTTCGGCTGTGCTGTTCCGTATTCTCTCCCTTGTCCGAGTGGCAG
CCACGCAGGCCGGCTCGGATGGCTTCCTCGATAGCTTTCCTTACGGCCTTGCCACGTCTGCTGGTCCAGCTGGCA
GCCGTCTGAGCGGCGGCCAGAGGCAACGTATTGCCCTCGCCCGCGCCTTGATCCGAAATCCATCGATGCTGATTC
TGGACGAGGCCACTGCTGCACTGGATTCGGCTACCGAAGCCCAAATCCAAGAAATCATCGCCAATCTCCCAGGCA
AGCGCACAATCCTTTGCATTGCCCATCGTCTGAGCACCGTTAGAGACGCCCACACAATCTTCGTGACGGGTCCAG
GCGGGCAGGTTCTTGAGCAAGGGAATTACGGGGAGTTGATGGGTATCGGCGGCGTCTTTGCGTCCATGGTTCGCT
CACAGGCCATTCTTGGGGACGGCCAGGACGACCGGAACACGGAGAAGACGGCGACAAGAACATCCAACGATGATC
AGGATCCGGAAAAGACGATGGAGTTGTTGCCCTGGGTACCTCAAAAGCAGCCCGACGTTGCGTCAAATAACGGCA
AGGTTTCCACGAGACCTCGGGGCGACGAACACGGGGCGACATGTCTCGACTCCCGCTACAACCGAGCCGAGAGGG
AGAAAAGCTTCTCTGCCACGTTCGCGCTAATGCTCAGGATGATACGCCCGCAGTTGCTACTCGTCGTCGTCGGAT
CATTATGCTCCATCGTCATCGGCGGCTCTCACGCGGGAGATGCCGTCATCTTTGGCAACGGGGTTGGGCACTTGT
CCGTCTGTCGTACGGCTTCTCAAGTGCGGAGAAGCGCCGCCCTCTACGGGCTTCTGTACTTTATCCTGGCCGTCG
TCGAGTTCTTCGCCCATTCGGTTTCGGTCGCGTGTTTTGGCTGGGTATCCGATCAGCTGGTTCGTCAGTTACGCT
CGTTGACGCTGCAATCGTTGCTCAAGCGACAAGTACCATGGCACGAGTCTGACGGCCGGACCCCGGGCACCTTGA
TGTCGCTCCTGAGCGCGGATGCCGCAGCCATGAGCGGGCTCACGGGCACGATCCTGGGCGCCTGTGTTTCTGTTC
TCGTCACGCTGGTGGCCGGCATCGTCCTTGCCCATGTGGTTGCATGGAAGGTGGCGGTGGTGCTCACGGCTTGTG
TCCCCCTCATCTTCGGCGCCGGGTTTCTTCGGATCCGTCTCTTTGCCAAGTTCGCCGAGCGGCACGCAAAGGCAT
TTGCCGAGTCGGTCAGTACGGCCGCCGAGTCCGTCAGCCATATACGGACCGTATCGGCGTTTGCGCTCCAGGACG
AGGTGGCCGGCACCTTTGGCAGGGCGTTGAAGGGTCCGTACAACGCCACGCTCAGGTCCATCACCTTTGGAACTG
TTTGGCTCGCGGCGGCCTTTAGTCTCGGCAGCCTGGTCAAGGCCCTGGCGTTTTATTGGGGAGGCCGGCTTATTG
CCGAGCGCGAGATCACCCAAACGTCCTTGTTCATCACCTTGGTCTCCTTGCTATCGGCCGCGCAGTTGAGCGGGC
AGATGTTTAGCCTCAGCCCGGATATCTCCAAGGCTGCTGTGGCTTCGCGTCGCGTATTTGGCCTCATCTTCTCCG
GCGGGCCGACGAACAGGTTGAACCTTGGGGGTTCGGCCGATGGCGAGAAGGGAGCATTGGCGATGACAGAGGGGG
GTTCGCTTGGGTCAACGGGACGAGGCATGGGCATGTCTGTGTCTTTCAAAAGTGTCTGGTTTTCATATCCGGGCC
AGCCTGAGGCGCACATTCTTCGCGATGTCTCCGTCGATATTCCAGCGGGCGCCTTTGTCGCCCTCGTGGGGGCCA
GCGGAGCAGGAAAGTCGACGATGCTTTCGCTATTACAGCGCCTATATAGGCCCCAGGCGGGAACCATCAGGCTCG
ACGGGTACGACGTCACGGGCCGCACTTCGAACAAGGAGAGGGACGACGAGGATGGTGACGACGATGGTGACGACG
ACACATGGCCATTCTGGGACGATGTGGCATTTGTGCCGCAAGATGCTACCCTGTTCTCGGGAAGCGTCGCCTTTA
ACATTGGCCTCGGTGGCCGAGGCACTGAGACCGTGACTATGGCCGAAATGGAGGCGGCGGCGCGGCTGGCCAACA
TACATGAGACAATCATCAGCCTCCCGGAAGGCTACGACACGTCTTGCGGGCCAACGGGCTCACAGCTTTTCTCCG
GGGGCCAGAAGCAGCGATTGTGCATTGCGCGTGCTTTGGTACGAAGACCACGTCTACTGCTTCTCGACGAGCCCA
GCAGCGCCATGGACGCAGAGAGCGAGGCGCTGTGGGAGACGTCGCTCGAGAGCATCATCCAGGCGGGCGAGGACG
GCCGGGGGAGGGTGACGGTCATTGGAATCGCCCACCGGCTGCGGACGATCATGAAGGCCGACAGGATATTCGTCA
TGGACGGCGGCCGGATCGTGGACGCGGGGACGCACAGGGAGTTGACTCGGCGATGCGAGCGATATCGCGACGACG
TGATGCACCAGACTTTAGAGTTAGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail