Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5158
Gene name
Locationscaffold_415:1473..4075
Strand+
Gene length (bp)2602
Transcript length (bp)1983
Coding sequence length (bp)1980
Protein length (aa) 660

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01179 Cu_amine_oxid Copper amine oxidase, enzyme domain 1.7E-158 227 638
PF02728 Cu_amine_oxidN3 Copper amine oxidase, N3 domain 8.7E-19 100 201
PF02727 Cu_amine_oxidN2 Copper amine oxidase, N2 domain 7.4E-13 8 92

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P12807|AMO_PICAN Peroxisomal primary amine oxidase OS=Pichia angusta GN=AMO PE=1 SV=1 8 653 0.0E+00
sp|O42890|CAO2_SCHPO Copper amine oxidase-like protein cao2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cao2 PE=3 SV=1 5 639 0.0E+00
sp|Q9P7F2|CAO1_SCHPO Copper amine oxidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cao1 PE=1 SV=1 9 653 0.0E+00
sp|Q07123|AMO2_ARTS1 Copper methylamine oxidase OS=Arthrobacter sp. (strain P1) GN=maoII PE=1 SV=1 8 649 1.0E-128
sp|Q07121|AMO1_ARTS1 Primary amine oxidase OS=Arthrobacter sp. (strain P1) GN=maoI PE=1 SV=1 8 649 2.0E-128
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P12807|AMO_PICAN Peroxisomal primary amine oxidase OS=Pichia angusta GN=AMO PE=1 SV=1 8 653 0.0E+00
sp|O42890|CAO2_SCHPO Copper amine oxidase-like protein cao2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cao2 PE=3 SV=1 5 639 0.0E+00
sp|Q9P7F2|CAO1_SCHPO Copper amine oxidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cao1 PE=1 SV=1 9 653 0.0E+00
sp|Q07123|AMO2_ARTS1 Copper methylamine oxidase OS=Arthrobacter sp. (strain P1) GN=maoII PE=1 SV=1 8 649 1.0E-128
sp|Q07121|AMO1_ARTS1 Primary amine oxidase OS=Arthrobacter sp. (strain P1) GN=maoI PE=1 SV=1 8 649 2.0E-128
sp|Q12556|AMO1_ASPNG Copper amine oxidase 1 OS=Aspergillus niger GN=AO-I PE=1 SV=2 8 647 3.0E-115
sp|Q59118|AMOH_ARTGO Histamine oxidase OS=Arthrobacter globiformis PE=1 SV=3 8 641 2.0E-112
sp|P46881|PAOX_ARTGO Phenylethylamine oxidase OS=Arthrobacter globiformis PE=1 SV=1 155 647 5.0E-104
sp|P49250|AMO_ENTAE Primary amine oxidase OS=Enterobacter aerogenes GN=maoA PE=1 SV=1 8 638 3.0E-75
sp|P46883|AMO_ECOLI Primary amine oxidase OS=Escherichia coli (strain K12) GN=tynA PE=1 SV=1 8 638 1.0E-69
sp|P80695|AMO_KLEOK Primary amine oxidase OS=Klebsiella oxytoca (strain ATCC 8724 / DSM 4798 / JCM 20051 / NBRC 3318 / NRRL B-199 / KCTC 1686) GN=maoA PE=1 SV=2 8 638 6.0E-69
sp|Q43077|AMO_PEA Primary amine oxidase OS=Pisum sativum PE=1 SV=1 7 654 2.0E-60
sp|P49252|AMO_LENCU Primary amine oxidase (Fragment) OS=Lens culinaris PE=1 SV=3 4 642 7.0E-57
sp|Q8H1H9|AMO_ARATH Primary amine oxidase OS=Arabidopsis thaliana GN=At1g62810 PE=2 SV=1 7 642 1.0E-54
sp|H2A0M3|AMO_PINMG Putative amine oxidase [copper-containing] OS=Pinctada margaritifera PE=1 SV=1 222 638 6.0E-33
sp|P36633|AOC1_RAT Amiloride-sensitive amine oxidase [copper-containing] OS=Rattus norvegicus GN=Aoc1 PE=2 SV=1 229 638 1.0E-28
sp|Q9TRC7|AOC1_PIG Amiloride-sensitive amine oxidase [copper-containing] OS=Sus scrofa GN=AOC1 PE=1 SV=3 172 638 2.0E-27
sp|Q8JZQ5|AOC1_MOUSE Amiloride-sensitive amine oxidase [copper-containing] OS=Mus musculus GN=Aoc1 PE=2 SV=1 229 638 7.0E-27
sp|P19801|AOC1_HUMAN Amiloride-sensitive amine oxidase [copper-containing] OS=Homo sapiens GN=AOC1 PE=1 SV=4 225 638 6.0E-26
sp|O75106|AOC2_HUMAN Retina-specific copper amine oxidase OS=Homo sapiens GN=AOC2 PE=1 SV=2 224 641 2.0E-23
sp|Q29437|AOCX_BOVIN Primary amine oxidase, liver isozyme OS=Bos taurus PE=1 SV=1 232 639 2.0E-22
sp|O08590|AOC3_RAT Membrane primary amine oxidase OS=Rattus norvegicus GN=Aoc3 PE=1 SV=4 231 641 3.0E-22
sp|O46406|AOCY_BOVIN Primary amine oxidase, lung isozyme OS=Bos taurus PE=2 SV=1 232 639 3.0E-21
sp|Q9TTK6|AOC3_BOVIN Membrane primary amine oxidase OS=Bos taurus GN=AOC3 PE=2 SV=3 232 639 4.0E-21
sp|Q812C9|AOC2_MOUSE Retina-specific copper amine oxidase OS=Mus musculus GN=Aoc2 PE=2 SV=2 224 641 3.0E-19
sp|Q5R9I0|AOC3_PONAB Membrane primary amine oxidase OS=Pongo abelii GN=AOC3 PE=2 SV=3 232 636 3.0E-19
sp|Q16853|AOC3_HUMAN Membrane primary amine oxidase OS=Homo sapiens GN=AOC3 PE=1 SV=3 232 636 5.0E-19
sp|O70423|AOC3_MOUSE Membrane primary amine oxidase OS=Mus musculus GN=Aoc3 PE=1 SV=3 231 636 3.0E-18
[Show less]

GO

GO Term Description Terminal node
GO:0005507 copper ion binding Yes
GO:0048038 quinone binding Yes
GO:0009308 amine metabolic process Yes
GO:0008131 primary amine oxidase activity Yes
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016491 oxidoreductase activity No
GO:0046872 metal ion binding No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0016638 oxidoreductase activity, acting on the CH-NH2 group of donors No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0046914 transition metal ion binding No
GO:0016641 oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5158
MASIQHHHPLDPLSSSEIQTAISLVREAHGGGVQFHTVTLQEPRKADMVRWLARRDAETRPARVADVVVVVAPGA
KVGEGLVNLAELQITRWAWLEGIQPIITVEELQAVEHVVRTDSRVVEQCQMIGIGREEMHKVFCDPWTIGYDARF
GSKVRLQQALMYFRPNLDDCQYQYPLDFCSLYDAGKRQVIHIDVPETRRPLRRTPAIGYHPAAVEAQGGYRKDLK
PIEISQPEGVSFRLDGRELTWLNWNFHIGFNYREGIVLNNLTYNDKGTVRPLFYRLSMAEMVVPYGEPEHPHQRK
HAFDLGEYGAGYMTNNLKLGCDCKGSIRYLDAVFSTSDGSVKRIENAVCIHEEDDGLLFKHTDFRDDSATVTRAR
RLVVQQIFTAANYEYVFQWIFYQDGTIKPEVKLTGILNTCSLGEGEDTKGWGTEVYPGVNAHNHQHLFCLRIDAN
IDGPQNTVFTVDAVAADAPVNSATNPYGNAFYARTTKLETTAQAMTDYHGESTRTWDICNTARLHPYSKRPVGYK
LISRHVPSLLPKPGSLVWKRAAFARHAVHVTRYRDDQLWPAGRHVPQTSGDTPIGLTEWIGDGSEPIDDEDIVVW
HTFGLNHFPAPEDFPIMPVESVSLLLRPRHFFASNPVLDCPPCHSLSPTQLSRPSLAEED
Coding >Ophio5|5158
ATGGCCTCTATCCAGCATCATCATCCCCTCGACCCTCTGTCGTCATCGGAGATTCAGACGGCGATATCGCTGGTG
CGAGAAGCCCACGGCGGTGGCGTGCAATTCCATACCGTCACGTTACAGGAGCCACGCAAGGCGGACATGGTCCGG
TGGCTGGCTCGGCGAGATGCCGAGACGAGACCGGCTCGGGTAGCCGATGTCGTCGTCGTGGTCGCGCCAGGAGCC
AAAGTCGGCGAGGGCCTCGTCAACCTCGCCGAGCTCCAAATCACCCGCTGGGCCTGGCTAGAGGGAATACAGCCG
ATTATCACGGTAGAGGAGCTTCAAGCTGTGGAACACGTCGTCAGAACCGATTCCCGTGTCGTGGAGCAATGCCAG
ATGATTGGAATCGGCCGAGAGGAGATGCACAAGGTCTTCTGCGACCCGTGGACCATCGGCTACGATGCCCGGTTC
GGCAGCAAGGTTCGCCTCCAGCAGGCCTTGATGTACTTCAGGCCCAACCTGGACGACTGTCAGTACCAATACCCC
CTGGACTTCTGTTCTCTATACGACGCGGGAAAGCGGCAGGTGATTCACATCGACGTGCCGGAGACGCGTCGGCCC
TTGCGACGGACCCCGGCCATCGGCTACCATCCGGCGGCTGTCGAGGCCCAAGGCGGTTATAGGAAGGACCTGAAG
CCTATCGAGATCAGCCAGCCGGAGGGCGTGTCGTTCCGCCTCGACGGCAGAGAGTTGACCTGGCTGAATTGGAAC
TTTCACATCGGCTTCAACTACCGGGAGGGCATCGTTCTGAATAATCTGACGTACAACGACAAGGGAACCGTCCGG
CCCCTTTTCTACCGTCTGTCCATGGCCGAAATGGTAGTTCCCTACGGCGAACCAGAGCATCCCCATCAGCGAAAA
CACGCCTTCGATCTGGGCGAGTACGGAGCTGGCTACATGACCAACAACCTCAAGCTCGGCTGCGACTGTAAAGGC
TCTATACGCTATCTCGACGCTGTCTTCTCGACTTCAGACGGGTCGGTGAAGAGGATTGAGAACGCAGTCTGTATC
CACGAGGAGGATGATGGCCTCCTCTTTAAGCATACCGATTTTCGTGATGATTCCGCTACGGTGACTCGGGCTCGA
CGTCTTGTTGTGCAGCAGATATTCACGGCGGCCAATTACGAATATGTCTTTCAGTGGATCTTCTACCAAGACGGC
ACCATCAAGCCCGAGGTCAAGTTGACGGGCATCCTCAACACATGCTCCCTCGGCGAGGGCGAAGACACCAAAGGC
TGGGGAACAGAGGTCTATCCCGGCGTCAACGCACATAACCATCAGCATCTTTTCTGCCTCCGCATCGACGCCAAC
ATCGACGGTCCGCAAAACACCGTCTTCACCGTCGACGCCGTAGCAGCAGACGCCCCTGTAAACAGTGCGACGAAT
CCGTATGGAAACGCCTTCTACGCGCGTACGACCAAGCTCGAGACGACGGCTCAGGCCATGACCGACTACCATGGC
GAATCGACGCGTACCTGGGATATTTGCAACACCGCCCGCCTTCATCCCTACAGCAAGAGGCCGGTGGGATACAAG
CTCATCAGCCGCCATGTTCCGTCCTTGTTGCCTAAGCCCGGGTCCCTGGTGTGGAAGCGGGCGGCCTTTGCGCGA
CACGCCGTCCACGTAACGAGGTACCGCGACGACCAGCTATGGCCCGCAGGCCGACACGTACCTCAAACATCAGGC
GACACACCCATCGGACTGACGGAATGGATCGGCGACGGCTCCGAGCCCATCGACGACGAGGACATCGTCGTCTGG
CACACCTTTGGCCTCAACCATTTCCCCGCCCCCGAGGATTTCCCCATCATGCCGGTCGAGTCGGTCAGTCTCTTG
CTGCGGCCTCGTCACTTCTTTGCTAGCAATCCGGTTCTGGATTGCCCGCCCTGTCATTCGCTTTCCCCCACTCAG
CTGTCCAGGCCGAGCTTGGCGGAGGAGGAC
Transcript >Ophio5|5158
ATGGCCTCTATCCAGCATCATCATCCCCTCGACCCTCTGTCGTCATCGGAGATTCAGACGGCGATATCGCTGGTG
CGAGAAGCCCACGGCGGTGGCGTGCAATTCCATACCGTCACGTTACAGGAGCCACGCAAGGCGGACATGGTCCGG
TGGCTGGCTCGGCGAGATGCCGAGACGAGACCGGCTCGGGTAGCCGATGTCGTCGTCGTGGTCGCGCCAGGAGCC
AAAGTCGGCGAGGGCCTCGTCAACCTCGCCGAGCTCCAAATCACCCGCTGGGCCTGGCTAGAGGGAATACAGCCG
ATTATCACGGTAGAGGAGCTTCAAGCTGTGGAACACGTCGTCAGAACCGATTCCCGTGTCGTGGAGCAATGCCAG
ATGATTGGAATCGGCCGAGAGGAGATGCACAAGGTCTTCTGCGACCCGTGGACCATCGGCTACGATGCCCGGTTC
GGCAGCAAGGTTCGCCTCCAGCAGGCCTTGATGTACTTCAGGCCCAACCTGGACGACTGTCAGTACCAATACCCC
CTGGACTTCTGTTCTCTATACGACGCGGGAAAGCGGCAGGTGATTCACATCGACGTGCCGGAGACGCGTCGGCCC
TTGCGACGGACCCCGGCCATCGGCTACCATCCGGCGGCTGTCGAGGCCCAAGGCGGTTATAGGAAGGACCTGAAG
CCTATCGAGATCAGCCAGCCGGAGGGCGTGTCGTTCCGCCTCGACGGCAGAGAGTTGACCTGGCTGAATTGGAAC
TTTCACATCGGCTTCAACTACCGGGAGGGCATCGTTCTGAATAATCTGACGTACAACGACAAGGGAACCGTCCGG
CCCCTTTTCTACCGTCTGTCCATGGCCGAAATGGTAGTTCCCTACGGCGAACCAGAGCATCCCCATCAGCGAAAA
CACGCCTTCGATCTGGGCGAGTACGGAGCTGGCTACATGACCAACAACCTCAAGCTCGGCTGCGACTGTAAAGGC
TCTATACGCTATCTCGACGCTGTCTTCTCGACTTCAGACGGGTCGGTGAAGAGGATTGAGAACGCAGTCTGTATC
CACGAGGAGGATGATGGCCTCCTCTTTAAGCATACCGATTTTCGTGATGATTCCGCTACGGTGACTCGGGCTCGA
CGTCTTGTTGTGCAGCAGATATTCACGGCGGCCAATTACGAATATGTCTTTCAGTGGATCTTCTACCAAGACGGC
ACCATCAAGCCCGAGGTCAAGTTGACGGGCATCCTCAACACATGCTCCCTCGGCGAGGGCGAAGACACCAAAGGC
TGGGGAACAGAGGTCTATCCCGGCGTCAACGCACATAACCATCAGCATCTTTTCTGCCTCCGCATCGACGCCAAC
ATCGACGGTCCGCAAAACACCGTCTTCACCGTCGACGCCGTAGCAGCAGACGCCCCTGTAAACAGTGCGACGAAT
CCGTATGGAAACGCCTTCTACGCGCGTACGACCAAGCTCGAGACGACGGCTCAGGCCATGACCGACTACCATGGC
GAATCGACGCGTACCTGGGATATTTGCAACACCGCCCGCCTTCATCCCTACAGCAAGAGGCCGGTGGGATACAAG
CTCATCAGCCGCCATGTTCCGTCCTTGTTGCCTAAGCCCGGGTCCCTGGTGTGGAAGCGGGCGGCCTTTGCGCGA
CACGCCGTCCACGTAACGAGGTACCGCGACGACCAGCTATGGCCCGCAGGCCGACACGTACCTCAAACATCAGGC
GACACACCCATCGGACTGACGGAATGGATCGGCGACGGCTCCGAGCCCATCGACGACGAGGACATCGTCGTCTGG
CACACCTTTGGCCTCAACCATTTCCCCGCCCCCGAGGATTTCCCCATCATGCCGGTCGAGTCGGTCAGTCTCTTG
CTGCGGCCTCGTCACTTCTTTGCTAGCAATCCGGTTCTGGATTGCCCGCCCTGTCATTCGCTTTCCCCCACTCAG
CTGTCCAGGCCGAGCTTGGCGGAGGAGGACTGA
Gene >Ophio5|5158
ATGGCCTCTATCCAGCATCATCATCCCCTCGACCCTCTGTCGTCATCGGAGATTCAGACGGCGATATCGCTGGTG
CGAGAAGCCCACGGCGGTGGCGTGCAATTCCATACCGTCACGTTACAGGAGCCACGCAAGGCGGACATGGTCCGG
TGGCTGGCTCGGCGAGATGCCGAGACGAGACCGGCTCGGGTAGCCGATGTCGTCGTCGTGGTCGCGCCAGGAGCC
AAAGTCGGCGAGGGCCTCGTCAACCTCGCCGAGCTCCAAATCACCCGCTGGGCCTGGCTAGAGGGAATACAGCCG
ATTGTAAGAAATACCCCCCTGATCCGTGTCGTTGTCAACAGCGCTGGCTAGCTAAACGCCCTTTTGCCTCTATCC
CTCCTTCTTCTACGCAGATCACGGTAGAGGAGCTTCAAGCTGTGGAACACGTCGTCAGAACCGATTCCCGTGTCG
TGGAGCAATGCCAGATGATTGGAATCGGCCGAGAGGAGATGCACAAGGTCTTCTGCGACCCGTGGACCATCGGCT
ACGATGCCCGGTTCGGCAGCAAGGTTCGCCTCCAGCAGGCCTTGATGTACTTCAGGCCCAACCTGGACGACTGTC
AGTACCAATACCCCCTGGACTTCTGTTCTCTATACGACGCGGGAAAGCGGCAGGTGATTCACATCGACGTGCCGG
AGACGCGTCGGCCCTTGCGACGGACCCCGGCCATCGGCTACCATCCGGCGGCTGTCGAGGCCCAAGGCGGTTATA
GGAAGGACCTGAAGCCTATCGAGATCAGCCAGCCGGAGGGCGTGTCGTTCCGCCTCGACGGCAGAGAGTTGACCT
GGCTGAATTGGAACTTTCACATCGGCTTCAACTACCGGGAGGGCATCGTTCTGAATAATCTGACGTACAACGACA
AGGGAACCGTCCGGCCCCTTTTCTACCGTCTGTCCATGGCCGAAATGGTAGTTCCCTAGTAGGGTTTCCCCCCCC
CCCCTCTAAAGCCTACGTTCCGCAGCTGAATAAAGGGGGGGGGTTGTCCCCAAAAAAACAGCGGCGAACCAGAGC
ATCCCCATCAGCGAAAACACGCCTTCGATCTGGGCGAGTACGGAGCTGGCTACATGACCAACAACCTCAAGCTCG
GCTGCGACTGTAAAGGCTCTATACGCTATCTCGACGCTGTCTTCTCGACTTCAGACGGGTCGGTGAAGAGGATTG
AGAACGCAGTCTGTATCCACGAGGAGGATGATGGCCTCCTCTTTAAGCATACCGATTTTCGTGATGATTCCGCTA
CGGTGACTCGGGCTCGACGTCTTGTTGTGCAGCAGATATTCACGGCGGCCAATTACGAATATGTCTTTCAGGTGC
GCGTATCCCGAGCTTGTCTTGTCCATGGTTGCCAAGGCCAGTATATTGATTCTCCTTTCTGTTTGTTTTTTTTTT
TTTCCAGTGGATCTTCTACGTGAGCCTCTTTCTTTTCTTTTCTTCGTCACTGCTATGGAAGACGACGGACGTTCC
TTTTTGACAGTCCCGTAGCAAGACGGCACCATCAAGCCCGAGGTCAAGTTGACGGGCATCCTCAACACATGCTCC
CTCGGCGAGGGCGAAGACACCAAAGGCTGGGGAACAGAGGTCTATCCCGGTAAGCGACGACGGGGGCGACACGTC
AAGCCCGAAAGGCTGATTCCTTTTTTTTCCCTTTTTTTTTTCACAATTTCAAGGCGTCAACGCACATAACCATCA
GCATCTTTTCTGCCTCCGCATCGACGCCAACATCGACGGTCCGCAAAACACCGTCTTCACCGTCGACGCCGTAGC
AGCAGACGCCCCTGTAAACAGTGCGACGAATCCGTATGGAAACGCCTTCTACGCGCGTACGACCAAGCTCGAGAC
GACGGCTCAGGCCATGACCGACTACCATGGCGAATCGACGCGTACCTGGGATATTTGCAACACCGCCCGCCTTCA
TCCCTACAGCAAGAGGCCGGTGGGATACAAGCTCATCAGCCGCCATGTTCCGTCCTTGTTGCCTAAGCCCGGGTC
CCTGGTGTGGAAGCGGGCGGCCTTTGCGCGACACGCCGTCCACGTAACGAGGTGTACGTTTTTATTTTATTTTTT
TTTATTTTTCTTTTTTTGCCTCCTGATAGAGACAATTGGTGGCAATGAGGTGCAAATGCCAAATGTAAAGAGGCA
TAGCCAGGCAGGAAAAAAGACGAGAGGAGAGAATCGTCACGACCCCCCTGAGTCGTCACCACCCCCTGAATCGTC
ACCACATCCATCCTCTAATTTCCCCCCCCCCCCCCCCCTAGACCGCGACGACCAGCTATGGCCCGCAGGCCGACA
CGTACCTCAAACATCAGGCGACACACCCATCGGACTGACGGAATGGATCGGCGACGGCTCCGAGCCCATCGACGA
CGAGGACATCGTCGTCTGGCACACCTTTGGCCTCAACCATTTCCCCGCCCCCGAGGATTTCCCCATCATGCCGGT
CGAGTCGGTCAGTCTCTTGCTGCGGCCTCGTCACTTCTTTGCTAGCAATCCGGTTCTGGATTGCCCGCCCTGTCA
TTCGCTTTCCCCCACTCAGCTGTCCAGGCCGAGCTTGGCGGAGGAGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail