Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5146
Gene name
Locationscaffold_413:13100..13970
Strand+
Gene length (bp)870
Transcript length (bp)579
Coding sequence length (bp)576
Protein length (aa) 192

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00347 Ribosomal_L6 Ribosomal protein L6 4.0E-14 12 85
PF00347 Ribosomal_L6 Ribosomal protein L6 2.3E-12 97 180

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P51401|RL9B_YEAST 60S ribosomal protein L9-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL9B PE=1 SV=1 1 192 3.0E-78
sp|P05738|RL9A_YEAST 60S ribosomal protein L9-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL9A PE=1 SV=2 1 192 1.0E-77
sp|Q10232|RL9A_SCHPO 60S ribosomal protein L9-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl901 PE=3 SV=1 4 191 2.0E-71
sp|O74905|RL9B_SCHPO 60S ribosomal protein L9-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl902 PE=3 SV=1 4 191 3.0E-71
sp|P49210|RL9_ORYSJ 60S ribosomal protein L9 OS=Oryza sativa subsp. japonica GN=RPL9 PE=2 SV=3 1 192 7.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P51401|RL9B_YEAST 60S ribosomal protein L9-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL9B PE=1 SV=1 1 192 3.0E-78
sp|P05738|RL9A_YEAST 60S ribosomal protein L9-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL9A PE=1 SV=2 1 192 1.0E-77
sp|Q10232|RL9A_SCHPO 60S ribosomal protein L9-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl901 PE=3 SV=1 4 191 2.0E-71
sp|O74905|RL9B_SCHPO 60S ribosomal protein L9-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl902 PE=3 SV=1 4 191 3.0E-71
sp|P49210|RL9_ORYSJ 60S ribosomal protein L9 OS=Oryza sativa subsp. japonica GN=RPL9 PE=2 SV=3 1 192 7.0E-63
sp|P51410|RL9_MOUSE 60S ribosomal protein L9 OS=Mus musculus GN=Rpl9 PE=1 SV=2 1 189 9.0E-63
sp|Q5IFJ7|RL9_MACFA 60S ribosomal protein L9 OS=Macaca fascicularis GN=RPL9 PE=2 SV=1 1 189 1.0E-62
sp|P32969|RL9_HUMAN 60S ribosomal protein L9 OS=Homo sapiens GN=RPL9 PE=1 SV=1 1 189 2.0E-62
sp|Q5R9Q7|RL9_PONAB 60S ribosomal protein L9 OS=Pongo abelii GN=RPL9 PE=2 SV=1 1 189 2.0E-62
sp|P17077|RL9_RAT 60S ribosomal protein L9 OS=Rattus norvegicus GN=Rpl9 PE=1 SV=1 1 189 2.0E-62
sp|Q3SYR7|RL9_BOVIN 60S ribosomal protein L9 OS=Bos taurus GN=RPL9 PE=2 SV=1 1 189 4.0E-62
sp|Q9SZX9|RL92_ARATH 60S ribosomal protein L9-2 OS=Arabidopsis thaliana GN=RPL9D PE=2 SV=1 1 189 1.0E-61
sp|P50882|RL9_DROME 60S ribosomal protein L9 OS=Drosophila melanogaster GN=RpL9 PE=1 SV=2 1 191 2.0E-61
sp|Q963B7|RL9_SPOFR 60S ribosomal protein L9 OS=Spodoptera frugiperda GN=RpL9 PE=2 SV=1 1 189 2.0E-61
sp|Q95Y90|RL9_CAEEL 60S ribosomal protein L9 OS=Caenorhabditis elegans GN=rpl-9 PE=3 SV=1 1 190 5.0E-61
sp|Q90YW0|RL9_ICTPU 60S ribosomal protein L9 OS=Ictalurus punctatus GN=rpl9 PE=2 SV=1 1 191 2.0E-60
sp|P49209|RL91_ARATH 60S ribosomal protein L9-1 OS=Arabidopsis thaliana GN=RPL9B PE=1 SV=3 1 192 1.0E-59
sp|P30707|RL9_PEA 60S ribosomal protein L9 OS=Pisum sativum GN=RPL9 PE=2 SV=1 1 190 1.0E-58
sp|Q54XI5|RL9_DICDI 60S ribosomal protein L9 OS=Dictyostelium discoideum GN=rpl9 PE=1 SV=2 1 191 7.0E-57
sp|Q22AX5|RL9_TETTS 60S ribosomal protein L9 OS=Tetrahymena thermophila (strain SB210) GN=RPL9 PE=1 SV=1 1 186 2.0E-42
sp|A2BMD5|RL6_HYPBU 50S ribosomal protein L6 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rpl6 PE=3 SV=1 2 187 9.0E-40
sp|O02376|RL9_HAECO 60S ribosomal protein L9 (Fragment) OS=Haemonchus contortus PE=2 SV=1 1 131 2.0E-35
sp|Q975J6|RL6_SULTO 50S ribosomal protein L6 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl6 PE=3 SV=1 1 186 7.0E-35
sp|Q9V1V1|RL6_PYRAB 50S ribosomal protein L6 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl6 PE=3 SV=1 7 188 2.0E-34
sp|Q5JJG4|RL6_THEKO 50S ribosomal protein L6 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl6 PE=3 SV=1 7 188 1.0E-33
sp|O59433|RL6_PYRHO 50S ribosomal protein L6 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl6 PE=3 SV=2 7 188 6.0E-33
sp|B6YSN0|RL6_THEON 50S ribosomal protein L6 OS=Thermococcus onnurineus (strain NA1) GN=rpl6 PE=3 SV=1 7 188 7.0E-33
sp|Q9YF91|RL6_AERPE 50S ribosomal protein L6 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl6 PE=3 SV=1 2 186 7.0E-33
sp|B8D5V4|RL6_DESK1 50S ribosomal protein L6 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=rpl6 PE=3 SV=1 2 187 1.0E-32
sp|Q18GG5|RL6_HALWD 50S ribosomal protein L6 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rpl6 PE=3 SV=1 10 186 4.0E-32
sp|P14135|RL6_HALMA 50S ribosomal protein L6 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl6 PE=1 SV=3 10 188 7.0E-32
sp|Q8U015|RL6_PYRFU 50S ribosomal protein L6 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl6 PE=1 SV=1 7 188 1.0E-31
sp|A3DNC3|RL6_STAMF 50S ribosomal protein L6 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rpl6 PE=3 SV=1 1 187 6.0E-31
sp|A0B9V4|RL6_METTP 50S ribosomal protein L6 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rpl6 PE=3 SV=1 10 186 6.0E-31
sp|P54042|RL6_METJA 50S ribosomal protein L6 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl6 PE=3 SV=1 7 187 7.0E-30
sp|Q9UX91|RL6_SULSO 50S ribosomal protein L6 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl6 PE=3 SV=1 1 186 9.0E-30
sp|C5A269|RL6_THEGJ 50S ribosomal protein L6 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpl6 PE=3 SV=1 7 188 3.0E-29
sp|Q3IMX2|RL6_NATPD 50S ribosomal protein L6 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rpl6 PE=3 SV=1 10 185 6.0E-29
sp|A6VH01|RL6_METM7 50S ribosomal protein L6 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl6 PE=3 SV=1 7 188 7.0E-29
sp|A4FWA5|RL6_METM5 50S ribosomal protein L6 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl6 PE=3 SV=1 7 188 8.0E-29
sp|Q9HPB8|RL6_HALSA 50S ribosomal protein L6 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl6 PE=1 SV=3 10 186 9.0E-29
sp|O26127|RL6_METTH 50S ribosomal protein L6 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl6 PE=3 SV=1 7 186 1.0E-28
sp|A8AC04|RL6_IGNH4 50S ribosomal protein L6 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rpl6 PE=3 SV=1 25 183 2.0E-28
sp|Q2NFX3|RL6_METST 50S ribosomal protein L6 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpl6 PE=3 SV=1 8 186 2.0E-28
sp|A9A9P8|RL6_METM6 50S ribosomal protein L6 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl6 PE=3 SV=1 7 188 1.0E-27
sp|Q6LXD7|RL6_METMP 50S ribosomal protein L6 OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl6 PE=3 SV=1 7 188 1.0E-27
sp|A5UL72|RL6_METS3 50S ribosomal protein L6 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rpl6 PE=3 SV=1 7 186 2.0E-27
sp|O05637|RL6_SULAC 50S ribosomal protein L6 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl6 PE=3 SV=1 1 186 7.0E-27
sp|Q0W1X2|RL6_METAR 50S ribosomal protein L6 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rpl6 PE=3 SV=1 10 186 1.0E-26
sp|Q8PV34|RL6_METMA 50S ribosomal protein L6 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpl6 PE=3 SV=1 10 187 1.0E-24
sp|A6UQ60|RL6_METVS 50S ribosomal protein L6 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl6 PE=3 SV=1 7 187 1.0E-24
sp|P14030|RL6_METVA 50S ribosomal protein L6 OS=Methanococcus vannielii GN=rpl6 PE=3 SV=1 7 187 1.0E-24
sp|A6UWV4|RL6_META3 50S ribosomal protein L6 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl6 PE=3 SV=1 51 188 3.0E-24
sp|Q8TRT1|RL6_METAC 50S ribosomal protein L6 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpl6 PE=3 SV=1 10 187 1.0E-23
sp|Q12ZT5|RL6_METBU 50S ribosomal protein L6 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rpl6 PE=3 SV=1 7 186 2.0E-23
sp|Q2FSG5|RL6_METHJ 50S ribosomal protein L6 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rpl6 PE=3 SV=1 7 183 2.0E-23
sp|Q8TW14|RL6_METKA 50S ribosomal protein L6 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl6 PE=3 SV=1 7 186 1.0E-21
sp|O28370|RL6_ARCFU 50S ribosomal protein L6 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpl6 PE=3 SV=1 19 186 4.0E-21
sp|Q46GB1|RL6_METBF 50S ribosomal protein L6 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl6 PE=3 SV=1 10 186 6.0E-21
sp|Q74MR6|RL6_NANEQ 50S ribosomal protein L6 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rpl6 PE=3 SV=1 10 192 2.0E-20
sp|Q8ZVA7|RL6_PYRAE 50S ribosomal protein L6 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpl6 PE=3 SV=1 1 173 1.0E-19
sp|Q97BW0|RL6_THEVO 50S ribosomal protein L6 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpl6 PE=3 SV=1 9 187 8.0E-15
sp|Q9HIS3|RL6_THEAC 50S ribosomal protein L6 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl6 PE=3 SV=1 10 187 1.0E-14
sp|Q6L1B1|RL6_PICTO 50S ribosomal protein L6 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rpl6 PE=3 SV=1 7 183 3.0E-12
sp|A6T3I9|RL6_JANMA 50S ribosomal protein L6 OS=Janthinobacterium sp. (strain Marseille) GN=rplF PE=3 SV=1 10 164 1.0E-09
sp|Q8ETW8|RL6_OCEIH 50S ribosomal protein L6 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rplF PE=3 SV=1 10 166 3.0E-09
sp|B8GV43|RL6_THISH 50S ribosomal protein L6 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rplF PE=3 SV=1 6 93 3.0E-09
sp|Q71WG1|RL6_LISMF 50S ribosomal protein L6 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rplF PE=3 SV=1 12 166 9.0E-09
sp|C1KZG5|RL6_LISMC 50S ribosomal protein L6 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rplF PE=3 SV=1 12 166 9.0E-09
sp|Q6LVA1|RL6_PHOPR 50S ribosomal protein L6 OS=Photobacterium profundum GN=rplF PE=3 SV=1 15 164 2.0E-08
sp|B8D0D9|RL6_HALOH 50S ribosomal protein L6 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=rplF PE=3 SV=1 10 168 2.0E-08
sp|A4SUX6|RL6_POLSQ 50S ribosomal protein L6 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rplF PE=3 SV=1 10 164 3.0E-08
sp|Q65P92|RL6_BACLD 50S ribosomal protein L6 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rplF PE=3 SV=1 6 166 3.0E-08
sp|A0ALV3|RL6_LISW6 50S ribosomal protein L6 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rplF PE=3 SV=1 12 166 3.0E-08
sp|Q927M2|RL6_LISIN 50S ribosomal protein L6 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rplF PE=3 SV=1 12 166 3.0E-08
sp|Q7W2E0|RL6_BORPA 50S ribosomal protein L6 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rplF PE=3 SV=1 10 165 4.0E-08
sp|Q7WRA8|RL6_BORBR 50S ribosomal protein L6 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rplF PE=3 SV=1 10 165 4.0E-08
sp|Q31IW7|RL6_THICR 50S ribosomal protein L6 OS=Thiomicrospira crunogena (strain XCL-2) GN=rplF PE=3 SV=1 6 164 4.0E-08
sp|B1XSR6|RL6_POLNS 50S ribosomal protein L6 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=rplF PE=3 SV=1 10 164 5.0E-08
sp|A4G9S3|RL6_HERAR 50S ribosomal protein L6 OS=Herminiimonas arsenicoxydans GN=rplF PE=3 SV=1 10 164 8.0E-08
sp|Q8Y444|RL6_LISMO 50S ribosomal protein L6 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rplF PE=3 SV=1 12 166 8.0E-08
sp|B8DB23|RL6_LISMH 50S ribosomal protein L6 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rplF PE=3 SV=1 12 166 8.0E-08
sp|Q7VTB6|RL6_BORPE 50S ribosomal protein L6 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rplF PE=3 SV=1 10 165 9.0E-08
sp|A1KB12|RL6_AZOSB 50S ribosomal protein L6 OS=Azoarcus sp. (strain BH72) GN=rplF PE=3 SV=1 12 164 1.0E-07
sp|A1VJ30|RL6_POLNA 50S ribosomal protein L6 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rplF PE=3 SV=1 12 166 2.0E-07
sp|B9DM32|RL6_STACT 50S ribosomal protein L6 OS=Staphylococcus carnosus (strain TM300) GN=rplF PE=3 SV=1 6 97 2.0E-07
sp|A8GYZ1|RL6_SHEPA 50S ribosomal protein L6 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rplF PE=3 SV=1 12 164 3.0E-07
sp|Q2L270|RL6_BORA1 50S ribosomal protein L6 OS=Bordetella avium (strain 197N) GN=rplF PE=3 SV=1 10 164 3.0E-07
sp|B0TLZ7|RL6_SHEHH 50S ribosomal protein L6 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rplF PE=3 SV=1 12 164 3.0E-07
sp|P0AG58|RL6_SHIFL 50S ribosomal protein L6 OS=Shigella flexneri GN=rplF PE=3 SV=2 12 164 5.0E-07
sp|Q0SZZ7|RL6_SHIF8 50S ribosomal protein L6 OS=Shigella flexneri serotype 5b (strain 8401) GN=rplF PE=3 SV=1 12 164 5.0E-07
sp|Q32B46|RL6_SHIDS 50S ribosomal protein L6 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rplF PE=3 SV=1 12 164 5.0E-07
sp|Q31VX1|RL6_SHIBS 50S ribosomal protein L6 OS=Shigella boydii serotype 4 (strain Sb227) GN=rplF PE=3 SV=1 12 164 5.0E-07
sp|B2U2S3|RL6_SHIB3 50S ribosomal protein L6 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rplF PE=3 SV=1 12 164 5.0E-07
sp|Q1R624|RL6_ECOUT 50S ribosomal protein L6 OS=Escherichia coli (strain UTI89 / UPEC) GN=rplF PE=3 SV=1 12 164 5.0E-07
sp|B1LHB9|RL6_ECOSM 50S ribosomal protein L6 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rplF PE=3 SV=1 12 164 5.0E-07
sp|B6I219|RL6_ECOSE 50S ribosomal protein L6 OS=Escherichia coli (strain SE11) GN=rplF PE=3 SV=1 12 164 5.0E-07
sp|B7NDS6|RL6_ECOLU 50S ribosomal protein L6 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rplF PE=3 SV=1 12 164 5.0E-07
sp|P0AG55|RL6_ECOLI 50S ribosomal protein L6 OS=Escherichia coli (strain K12) GN=rplF PE=1 SV=2 12 164 5.0E-07
sp|B1IPZ4|RL6_ECOLC 50S ribosomal protein L6 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rplF PE=3 SV=1 12 164 5.0E-07
sp|P0AG56|RL6_ECOL6 50S ribosomal protein L6 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rplF PE=3 SV=2 12 164 5.0E-07
sp|Q0TCF6|RL6_ECOL5 50S ribosomal protein L6 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rplF PE=3 SV=1 12 164 5.0E-07
sp|A1AGJ4|RL6_ECOK1 50S ribosomal protein L6 OS=Escherichia coli O1:K1 / APEC GN=rplF PE=3 SV=1 12 164 5.0E-07
sp|A8A5B0|RL6_ECOHS 50S ribosomal protein L6 OS=Escherichia coli O9:H4 (strain HS) GN=rplF PE=3 SV=1 12 164 5.0E-07
sp|B1X6F7|RL6_ECODH 50S ribosomal protein L6 OS=Escherichia coli (strain K12 / DH10B) GN=rplF PE=3 SV=1 12 164 5.0E-07
sp|C4ZUG0|RL6_ECOBW 50S ribosomal protein L6 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rplF PE=3 SV=1 12 164 5.0E-07
sp|B7M1L9|RL6_ECO8A 50S ribosomal protein L6 OS=Escherichia coli O8 (strain IAI1) GN=rplF PE=3 SV=1 12 164 5.0E-07
sp|B7N189|RL6_ECO81 50S ribosomal protein L6 OS=Escherichia coli O81 (strain ED1a) GN=rplF PE=3 SV=1 12 164 5.0E-07
sp|B7NLM4|RL6_ECO7I 50S ribosomal protein L6 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rplF PE=3 SV=1 12 164 5.0E-07
sp|B5YTM6|RL6_ECO5E 50S ribosomal protein L6 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rplF PE=3 SV=1 12 164 5.0E-07
sp|P0AG57|RL6_ECO57 50S ribosomal protein L6 OS=Escherichia coli O157:H7 GN=rplF PE=3 SV=2 12 164 5.0E-07
sp|B7LI04|RL6_ECO55 50S ribosomal protein L6 OS=Escherichia coli (strain 55989 / EAEC) GN=rplF PE=3 SV=1 12 164 5.0E-07
sp|B7MCS0|RL6_ECO45 50S ribosomal protein L6 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rplF PE=3 SV=1 12 164 5.0E-07
sp|B7UK29|RL6_ECO27 50S ribosomal protein L6 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rplF PE=3 SV=1 12 164 5.0E-07
sp|A7ZSJ4|RL6_ECO24 50S ribosomal protein L6 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rplF PE=3 SV=1 12 164 5.0E-07
sp|B2GDV4|RL6_LACF3 50S ribosomal protein L6 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rplF PE=3 SV=1 10 166 5.0E-07
sp|A9BRW6|RL6_DELAS 50S ribosomal protein L6 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rplF PE=3 SV=1 12 166 5.0E-07
sp|Q39XZ1|RL6_GEOMG 50S ribosomal protein L6 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rplF PE=3 SV=1 10 166 7.0E-07
sp|A9IHT3|RL6_BORPD 50S ribosomal protein L6 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rplF PE=3 SV=1 10 164 7.0E-07
sp|B7LRS1|RL6_ESCF3 50S ribosomal protein L6 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rplF PE=3 SV=1 12 164 8.0E-07
sp|Q2S927|RL6_HAHCH 50S ribosomal protein L6 OS=Hahella chejuensis (strain KCTC 2396) GN=rplF PE=3 SV=1 10 166 9.0E-07
sp|B7IHW1|RL6_THEAB 50S ribosomal protein L6 OS=Thermosipho africanus (strain TCF52B) GN=rplF PE=3 SV=1 12 165 9.0E-07
sp|Q3YWV4|RL6_SHISS 50S ribosomal protein L6 OS=Shigella sonnei (strain Ss046) GN=rplF PE=3 SV=1 12 93 1.0E-06
sp|B8DNB1|RL6_DESVM 50S ribosomal protein L6 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rplF PE=3 SV=1 10 168 1.0E-06
sp|C5CQ85|RL6_VARPS 50S ribosomal protein L6 OS=Variovorax paradoxus (strain S110) GN=rplF PE=3 SV=1 10 166 1.0E-06
sp|A1WVA7|RL6_HALHL 50S ribosomal protein L6 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rplF PE=3 SV=1 10 164 1.0E-06
sp|B1JIX6|RL6_YERPY 50S ribosomal protein L6 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rplF PE=3 SV=1 12 93 1.0E-06
sp|Q664T6|RL6_YERPS 50S ribosomal protein L6 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rplF PE=3 SV=1 12 93 1.0E-06
sp|A4TH07|RL6_YERPP 50S ribosomal protein L6 OS=Yersinia pestis (strain Pestoides F) GN=rplF PE=3 SV=1 12 93 1.0E-06
sp|Q1CCV9|RL6_YERPN 50S ribosomal protein L6 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rplF PE=3 SV=1 12 93 1.0E-06
sp|A9R910|RL6_YERPG 50S ribosomal protein L6 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rplF PE=3 SV=1 12 93 1.0E-06
sp|Q7CFT4|RL6_YERPE 50S ribosomal protein L6 OS=Yersinia pestis GN=rplF PE=3 SV=1 12 93 1.0E-06
sp|B2K522|RL6_YERPB 50S ribosomal protein L6 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rplF PE=3 SV=1 12 93 1.0E-06
sp|Q1C2W2|RL6_YERPA 50S ribosomal protein L6 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rplF PE=3 SV=1 12 93 1.0E-06
sp|A7FNL9|RL6_YERP3 50S ribosomal protein L6 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rplF PE=3 SV=1 12 93 1.0E-06
sp|Q1LI52|RL6_CUPMC 50S ribosomal protein L6 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rplF PE=3 SV=1 10 164 1.0E-06
sp|Q2NQN7|RL6_SODGM 50S ribosomal protein L6 OS=Sodalis glossinidius (strain morsitans) GN=rplF PE=3 SV=1 12 93 1.0E-06
sp|A5GAV7|RL6_GEOUR 50S ribosomal protein L6 OS=Geobacter uraniireducens (strain Rf4) GN=rplF PE=3 SV=1 10 166 1.0E-06
sp|Q92GY1|RL6_RICCN 50S ribosomal protein L6 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rplF PE=3 SV=1 10 163 2.0E-06
sp|Q5P317|RL6_AROAE 50S ribosomal protein L6 OS=Aromatoleum aromaticum (strain EbN1) GN=rplF PE=3 SV=1 10 164 2.0E-06
sp|Q749A2|RL6_GEOSL 50S ribosomal protein L6 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rplF PE=3 SV=1 10 166 2.0E-06
sp|A1W323|RL6_ACISJ 50S ribosomal protein L6 OS=Acidovorax sp. (strain JS42) GN=rplF PE=3 SV=1 10 166 2.0E-06
sp|B9MBV2|RL6_ACIET 50S ribosomal protein L6 OS=Acidovorax ebreus (strain TPSY) GN=rplF PE=3 SV=1 10 166 2.0E-06
sp|Q1WSA5|RL6_LACS1 50S ribosomal protein L6 OS=Lactobacillus salivarius (strain UCC118) GN=rplF PE=3 SV=1 9 90 2.0E-06
sp|Q8FS54|RL6_COREF 50S ribosomal protein L6 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=rplF PE=3 SV=1 10 168 2.0E-06
sp|B5XNA8|RL6_KLEP3 50S ribosomal protein L6 OS=Klebsiella pneumoniae (strain 342) GN=rplF PE=3 SV=1 12 164 2.0E-06
sp|C6C1A0|RL6_DESAD 50S ribosomal protein L6 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rplF PE=3 SV=1 10 101 2.0E-06
sp|A3CK79|RL6_STRSV 50S ribosomal protein L6 OS=Streptococcus sanguinis (strain SK36) GN=rplF PE=3 SV=1 12 166 2.0E-06
sp|B4F1J9|RL6_PROMH 50S ribosomal protein L6 OS=Proteus mirabilis (strain HI4320) GN=rplF PE=3 SV=1 12 93 2.0E-06
sp|A1JS15|RL6_YERE8 50S ribosomal protein L6 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rplF PE=3 SV=1 12 93 2.0E-06
sp|A6W377|RL6_MARMS 50S ribosomal protein L6 OS=Marinomonas sp. (strain MWYL1) GN=rplF PE=3 SV=1 10 164 3.0E-06
sp|A8GT54|RL6_RICRS 50S ribosomal protein L6 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rplF PE=3 SV=1 10 163 3.0E-06
sp|B0BUP5|RL6_RICRO 50S ribosomal protein L6 OS=Rickettsia rickettsii (strain Iowa) GN=rplF PE=3 SV=1 10 163 3.0E-06
sp|Q1RHN6|RL6_RICBR 50S ribosomal protein L6 OS=Rickettsia bellii (strain RML369-C) GN=rplF PE=3 SV=1 12 90 3.0E-06
sp|A8GVC9|RL6_RICB8 50S ribosomal protein L6 OS=Rickettsia bellii (strain OSU 85-389) GN=rplF PE=3 SV=1 12 90 3.0E-06
sp|Q4UMR4|RL6_RICFE 50S ribosomal protein L6 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rplF PE=3 SV=1 10 163 3.0E-06
sp|B2VK81|RL6_ERWT9 50S ribosomal protein L6 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rplF PE=3 SV=1 12 93 3.0E-06
sp|Q73PL7|RL6_TREDE 50S ribosomal protein L6 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rplF PE=3 SV=1 12 166 3.0E-06
sp|B5FJJ9|RL6_SALDC 50S ribosomal protein L6 OS=Salmonella dublin (strain CT_02021853) GN=rplF PE=3 SV=1 12 164 4.0E-06
sp|A7MPG5|RL6_CROS8 50S ribosomal protein L6 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rplF PE=3 SV=1 12 164 4.0E-06
sp|P66313|RL6_SALTY 50S ribosomal protein L6 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rplF PE=3 SV=2 12 164 4.0E-06
sp|P66314|RL6_SALTI 50S ribosomal protein L6 OS=Salmonella typhi GN=rplF PE=3 SV=2 12 164 4.0E-06
sp|B4TXC7|RL6_SALSV 50S ribosomal protein L6 OS=Salmonella schwarzengrund (strain CVM19633) GN=rplF PE=3 SV=1 12 164 4.0E-06
sp|B5BGX1|RL6_SALPK 50S ribosomal protein L6 OS=Salmonella paratyphi A (strain AKU_12601) GN=rplF PE=3 SV=1 12 164 4.0E-06
sp|C0PZW8|RL6_SALPC 50S ribosomal protein L6 OS=Salmonella paratyphi C (strain RKS4594) GN=rplF PE=3 SV=1 12 164 4.0E-06
sp|A9MSY3|RL6_SALPB 50S ribosomal protein L6 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rplF PE=3 SV=1 12 164 4.0E-06
sp|Q5PIU8|RL6_SALPA 50S ribosomal protein L6 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rplF PE=3 SV=1 12 164 4.0E-06
sp|B4SUS5|RL6_SALNS 50S ribosomal protein L6 OS=Salmonella newport (strain SL254) GN=rplF PE=3 SV=1 12 164 4.0E-06
sp|B4TJZ4|RL6_SALHS 50S ribosomal protein L6 OS=Salmonella heidelberg (strain SL476) GN=rplF PE=3 SV=1 12 164 4.0E-06
sp|B5RH30|RL6_SALG2 50S ribosomal protein L6 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rplF PE=3 SV=1 12 164 4.0E-06
sp|B5R1G2|RL6_SALEP 50S ribosomal protein L6 OS=Salmonella enteritidis PT4 (strain P125109) GN=rplF PE=3 SV=1 12 164 4.0E-06
sp|Q57J47|RL6_SALCH 50S ribosomal protein L6 OS=Salmonella choleraesuis (strain SC-B67) GN=rplF PE=3 SV=1 12 164 4.0E-06
sp|B5F7T0|RL6_SALA4 50S ribosomal protein L6 OS=Salmonella agona (strain SL483) GN=rplF PE=3 SV=1 12 164 4.0E-06
sp|Q5WLP7|RL6_BACSK 50S ribosomal protein L6 OS=Bacillus clausii (strain KSM-K16) GN=rplF PE=3 SV=1 12 90 4.0E-06
sp|A6TEV7|RL6_KLEP7 50S ribosomal protein L6 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rplF PE=3 SV=1 12 93 4.0E-06
sp|A7MWH2|RL6_VIBCB 50S ribosomal protein L6 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rplF PE=3 SV=1 6 90 4.0E-06
sp|C4K2G4|RL6_RICPU 50S ribosomal protein L6 OS=Rickettsia peacockii (strain Rustic) GN=rplF PE=3 SV=1 10 163 4.0E-06
sp|Q5QXW0|RL6_IDILO 50S ribosomal protein L6 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rplF PE=3 SV=1 10 93 4.0E-06
sp|B3PK52|RL6_CELJU 50S ribosomal protein L6 OS=Cellvibrio japonicus (strain Ueda107) GN=rplF PE=3 SV=1 10 164 5.0E-06
sp|Q0VSI8|RL6_ALCBS 50S ribosomal protein L6 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rplF PE=3 SV=1 6 93 5.0E-06
sp|C3PP92|RL6_RICAE 50S ribosomal protein L6 OS=Rickettsia africae (strain ESF-5) GN=rplF PE=3 SV=1 10 163 5.0E-06
sp|B8CNE8|RL6_SHEPW 50S ribosomal protein L6 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rplF PE=3 SV=1 6 164 5.0E-06
sp|Q8CRH5|RL6_STAES 50S ribosomal protein L6 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rplF PE=3 SV=1 6 97 5.0E-06
sp|Q5HM14|RL6_STAEQ 50S ribosomal protein L6 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rplF PE=3 SV=1 6 97 5.0E-06
sp|A8AZL0|RL6_STRGC 50S ribosomal protein L6 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rplF PE=3 SV=1 12 166 5.0E-06
sp|Q47J88|RL6_DECAR 50S ribosomal protein L6 OS=Dechloromonas aromatica (strain RCB) GN=rplF PE=3 SV=1 12 164 6.0E-06
sp|B3WAK3|RL6_LACCB 50S ribosomal protein L6 OS=Lactobacillus casei (strain BL23) GN=rplF PE=3 SV=1 8 166 6.0E-06
sp|Q034Z8|RL6_LACC3 50S ribosomal protein L6 OS=Lactobacillus casei (strain ATCC 334) GN=rplF PE=3 SV=1 8 166 6.0E-06
sp|Q0K634|RL6_CUPNH 50S ribosomal protein L6 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rplF PE=3 SV=1 10 164 6.0E-06
sp|A8AQK0|RL6_CITK8 50S ribosomal protein L6 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rplF PE=3 SV=1 12 164 6.0E-06
sp|Q4L899|RL6_STAHJ 50S ribosomal protein L6 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rplF PE=3 SV=1 6 93 7.0E-06
sp|B2UEK4|RL6_RALPJ 50S ribosomal protein L6 OS=Ralstonia pickettii (strain 12J) GN=rplF PE=3 SV=1 10 164 7.0E-06
sp|A0KF36|RL6_AERHH 50S ribosomal protein L6 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rplF PE=3 SV=1 6 164 7.0E-06
sp|A9MN63|RL6_SALAR 50S ribosomal protein L6 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rplF PE=3 SV=1 12 164 8.0E-06
sp|Q3SSV1|RL6_NITWN 50S ribosomal protein L6 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rplF PE=3 SV=1 10 164 8.0E-06
sp|A8G1D3|RL6_SHESH 50S ribosomal protein L6 OS=Shewanella sediminis (strain HAW-EB3) GN=rplF PE=3 SV=1 6 164 8.0E-06
sp|A8F2D2|RL6_RICM5 50S ribosomal protein L6 OS=Rickettsia massiliae (strain Mtu5) GN=rplF PE=3 SV=1 10 163 8.0E-06
sp|A4WFB3|RL6_ENT38 50S ribosomal protein L6 OS=Enterobacter sp. (strain 638) GN=rplF PE=3 SV=1 12 93 8.0E-06
sp|A4JAQ5|RL6_BURVG 50S ribosomal protein L6 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rplF PE=3 SV=1 14 164 9.0E-06
sp|A4XLR5|RL6_CALS8 50S ribosomal protein L6 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rplF PE=3 SV=1 10 87 1.0E-05
sp|Q03IG6|RL6_STRTD 50S ribosomal protein L6 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rplF PE=3 SV=1 9 166 1.0E-05
sp|Q5M2C8|RL6_STRT2 50S ribosomal protein L6 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rplF PE=3 SV=1 9 166 1.0E-05
sp|Q5LXS6|RL6_STRT1 50S ribosomal protein L6 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rplF PE=3 SV=1 9 166 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0019843 rRNA binding Yes
GO:0003676 nucleic acid binding No
GO:0071704 organic substance metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0043226 organelle No
GO:1901576 organic substance biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0044238 primary metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043228 non-membrane-bounded organelle No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0009058 biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043604 amide biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043043 peptide biosynthetic process No
GO:0003723 RNA binding No
GO:0005198 structural molecule activity No
GO:0097159 organic cyclic compound binding No
GO:0005575 cellular_component No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043229 intracellular organelle No
GO:0019538 protein metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0043603 cellular amide metabolic process No
GO:0009987 cellular process No
GO:0005488 binding No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5146
MKYIHSQELLDIPEGVKVSIKSRIVTVEGPRGKLVKDLSHLSVNFGHPKKNTISIEIHHGSRKDVATLRTVRSII
NNLVIGVTKGFKYKMRYVYAHFPINVNLDKNKETDLWEVEIRNFIGEKIVRRVKMQEGVDVEISKTQKDELILSG
NSLENVSQSAADIQQICKVRNKDIRKFLDGLYVSEKGNIIED
Coding >Ophio5|5146
ATGAAGTACATTCATTCGCAGGAGCTCCTCGACATCCCCGAGGGTGTCAAGGTCTCGATCAAGTCGCGAATCGTC
ACCGTCGAAGGCCCCCGAGGCAAGCTGGTCAAGGACCTGAGCCATCTGTCGGTCAACTTTGGCCACCCCAAGAAG
AACACCATCTCGATCGAGATCCACCACGGCTCGCGCAAGGATGTGGCCACGCTGCGGACGGTGCGCTCCATCATC
AACAACCTCGTGATCGGTGTCACCAAGGGCTTCAAGTACAAGATGCGCTACGTCTACGCTCACTTTCCCATCAAT
GTCAACCTCGACAAGAACAAGGAGACGGACCTCTGGGAAGTTGAGATCCGGAACTTCATCGGCGAGAAGATTGTC
CGCCGGGTGAAGATGCAGGAGGGCGTCGACGTCGAGATCTCCAAGACGCAAAAGGACGAGCTCATCCTGTCGGGC
AACTCGCTAGAAAATGTGTCCCAAAGCGCCGCCGATATTCAGCAGATCTGCAAAGTCCGGAACAAGGACATTCGA
AAATTCCTGGACGGCCTGTACGTTTCCGAAAAGGGCAACATCATCGAGGAC
Transcript >Ophio5|5146
ATGAAGTACATTCATTCGCAGGAGCTCCTCGACATCCCCGAGGGTGTCAAGGTCTCGATCAAGTCGCGAATCGTC
ACCGTCGAAGGCCCCCGAGGCAAGCTGGTCAAGGACCTGAGCCATCTGTCGGTCAACTTTGGCCACCCCAAGAAG
AACACCATCTCGATCGAGATCCACCACGGCTCGCGCAAGGATGTGGCCACGCTGCGGACGGTGCGCTCCATCATC
AACAACCTCGTGATCGGTGTCACCAAGGGCTTCAAGTACAAGATGCGCTACGTCTACGCTCACTTTCCCATCAAT
GTCAACCTCGACAAGAACAAGGAGACGGACCTCTGGGAAGTTGAGATCCGGAACTTCATCGGCGAGAAGATTGTC
CGCCGGGTGAAGATGCAGGAGGGCGTCGACGTCGAGATCTCCAAGACGCAAAAGGACGAGCTCATCCTGTCGGGC
AACTCGCTAGAAAATGTGTCCCAAAGCGCCGCCGATATTCAGCAGATCTGCAAAGTCCGGAACAAGGACATTCGA
AAATTCCTGGACGGCCTGTACGTTTCCGAAAAGGGCAACATCATCGAGGACTAG
Gene >Ophio5|5146
ATGAAGTACATTCATTCGCAGGAGCTCCTCGACATCCCCGAGGGTGGTACGTGGCGATTCCATCCATGACGCATT
TGCAGGGTCGTCTCTTCCTCCGCAGCGACTGTGACCGACGAGGAGAGATGAATTGGGGGGGGGGGGGGAGCAGAT
CGGGGGGGAAACACGCATGGGAGAAGAATGAAAATATGGCTGACCAACTTGCGCCTACAGTCAAGGTCTCGATCA
AGTCGCGAATCGTCACCGTCGAAGGCCCCCGAGGTGGGAGGCCCTCCGCCAAACGCGTCGACGGGGCCGAGCTCT
GACGTACATCGCAGGCAAGCTGGTCAAGGACCTGAGCCATCTGTCGGTCAACTTTGGCCACCCCAAGAAGAACAC
CATCTCGATCGAGATCCACCACGGCTCGCGCAAGGATGTGGCCACGCTGCGGACGGTGCGCTCCATCATCAACAA
CCTCGTGATCGGTGTCACCAAGGGCTTCAAGTACAAGATGCGCTACGTCTACGCTCACTTTCCCATCAATGTCAA
CCTCGACAAGAACAAGGAGACGGACCTCTGGGAAGTTGAGATCCGGAACTTCATCGGCGAGAAGATTGTCCGCCG
GGTGAAGATGCAGGAGGGCGTCGACGTCGAGATCTCCAAGACGCAAAAGGACGAGCTCATCCTGTCGGGCAACTC
GCTAGAAAATGTGTCCCAAAGCGCCGCCGATATTCAGCAGATCTGCAAAGTCCGGAACAAGGACATTCGAAAAGT
CGGTTCTTGTTGCCCAGACTTCTCCGCTTGGCTTCATCACCAAGGTTTCGCTGACTTTGACCGCACCAGTTCCTG
GACGGCCTGTACGTTTCCGAAAAGGGCAACATCATCGAGGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail