Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5144
Gene name
Locationscaffold_413:7561..11166
Strand+
Gene length (bp)3605
Transcript length (bp)3492
Coding sequence length (bp)3489
Protein length (aa) 1163

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11715 Nup160 Nucleoporin Nup120/160 1.4E-140 28 574

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G0S0E7|NU120_CHATD Nucleoporin NUP120 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP120 PE=3 SV=1 9 1117 0.0E+00
sp|O43044|NU120_SCHPO Nucleoporin nup120 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup120 PE=1 SV=1 46 566 3.0E-16
sp|O43044|NU120_SCHPO Nucleoporin nup120 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup120 PE=1 SV=1 806 1145 5.0E-12
sp|Q9Z0W3|NU160_MOUSE Nuclear pore complex protein Nup160 OS=Mus musculus GN=Nup160 PE=1 SV=2 855 1136 8.0E-12
sp|Q12769|NU160_HUMAN Nuclear pore complex protein Nup160 OS=Homo sapiens GN=NUP160 PE=1 SV=3 855 1125 5.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G0S0E7|NU120_CHATD Nucleoporin NUP120 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP120 PE=3 SV=1 9 1117 0.0E+00
sp|O43044|NU120_SCHPO Nucleoporin nup120 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup120 PE=1 SV=1 46 566 3.0E-16
sp|O43044|NU120_SCHPO Nucleoporin nup120 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup120 PE=1 SV=1 806 1145 5.0E-12
sp|Q9Z0W3|NU160_MOUSE Nuclear pore complex protein Nup160 OS=Mus musculus GN=Nup160 PE=1 SV=2 855 1136 8.0E-12
sp|Q12769|NU160_HUMAN Nuclear pore complex protein Nup160 OS=Homo sapiens GN=NUP160 PE=1 SV=3 855 1125 5.0E-11
sp|Q12769|NU160_HUMAN Nuclear pore complex protein Nup160 OS=Homo sapiens GN=NUP160 PE=1 SV=3 272 558 1.0E-09
sp|Q9Z0W3|NU160_MOUSE Nuclear pore complex protein Nup160 OS=Mus musculus GN=Nup160 PE=1 SV=2 259 584 2.0E-09
sp|Q9VKJ3|NU160_DROME Nuclear pore complex protein Nup160 homolog OS=Drosophila melanogaster GN=Nup160 PE=1 SV=1 923 1135 3.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear export signal 0.4576 0.7485 0.0809 0.0461 0.047 0.0038 0.1021 0.3589 0.2365 0.0033

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1997
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6492
Ophiocordyceps australis map64 (Brazil) OphauB2|7803
Ophiocordyceps camponoti-floridani Ophcf2|07377
Ophiocordyceps camponoti-rufipedis Ophun1|3213
Ophiocordyceps kimflemingae Ophio5|5144 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2234

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5144
MEQQDTHYLFKETRLNLETPSPAVEVSIRVPSKTGGARAQQRLLPASDPSADDETTFRLKNLAVASSVYHRKWHD
APRSFLWRVLDDGRVLSIRVVDLCKRDKAPDAPLVLHFSFSLPIQPGCVAFSDPQEHDALCVFVLDQASQLFTFT
LRPDLFRRRTAVDASLSELGKVQSPAGLSFKTPHRLVAVTSNILLATVNDGGMIRFDRSKSDDATNGMWKESFFN
VQGWTQNLRSLLPFQGKHVVRHGRVNMEYTATTSLQVTSFGLDQGLFAVTVCLDHRMRIWNVDDGQILYTGDILN
SERPSQEVGKWTIDPSQSNLVHLVGRHRGQRICATYSPIGSGEFKFWKLVVRDAHTITVEDLFPENRLLPPSPTS
PDIWTMADFVLASPSEGSIILWTLWKNNLTYRVQCLEVDRDNMERTWEDGWDGAFPEPVLAAVPVSDPCDPTDVT
EKWLQAIFQPGRFTKATLETALSIYERGLGATRDTTRGRSLAESICSVLGSTASLERGSSGAMDYELFRTSNETQ
WRRFYRLLNELDKQRGEAVGLALDPETDMTWVVCTDLVSAITECSSLERVCHNLSSPDEEQQNLAALVGTALAFV
DGFPDAYVQLSKAALRQEVFEQSSKTDLERIQYFSDKAAFWRGITDEDCAQVVDALDANFGIVTDGLYRDVLGLV
AAPLEAKRRHLRHPLTEFGKKLIMKGVQDCIELQRKVCFSQLVLLVHMEFEFDKEDEALHHRVDIGLVFRELVNA
LKRLELLDWLARTELSVPLFRSEKGTPAPALRKGDGGDESQVITALEANVGHLLGFGHARNEPLSLTITELVANL
CAPDSDIEVSPTLIQCSLVKHDRADLALALAPFCDQHPFSVYINGRVLLVLKDLEAAAINFRKAAVGMGNELVMS
DRHSCGLLDDTEWNLLNSGQAKYYAHITALYEEQRAYSYVMEYARLAIQFAGLSGSGDGTKTDMLSRLFHAALAM
SQFELAHTSLFSMKDEALRRSSLRLLVDKMCDTYHSTELVALPFPGMQQEVDAMLAQRCKASADPVHGFPYHQVL
YSWRIRRNNYRGAAAVLLDRIQRLKLAGEGDKMTGEDVLDTPVTRQYLLLINALSCVDPKQAWVFEEGAAGSKRN
VVSLADIRKQYRDELDRIAAIQNNQFGFEADDDVMDIA
Coding >Ophio5|5144
ATGGAGCAACAAGACACACACTATCTCTTTAAAGAGACCCGACTGAACCTCGAGACTCCCTCGCCAGCCGTCGAA
GTCAGCATCCGCGTACCATCCAAGACGGGCGGTGCCCGTGCCCAGCAAAGACTGCTGCCAGCAAGCGATCCGTCG
GCCGACGACGAGACGACGTTCCGGCTCAAGAACCTGGCCGTCGCATCGTCCGTCTATCACAGGAAGTGGCATGAC
GCGCCGCGCAGTTTTCTATGGCGCGTCCTCGACGATGGCCGCGTGCTGAGTATCCGCGTCGTCGATCTTTGCAAG
CGCGACAAGGCGCCTGACGCGCCCCTGGTGCTACACTTCTCCTTTTCCCTACCCATACAGCCCGGGTGCGTGGCC
TTTTCCGATCCGCAGGAGCACGACGCGCTTTGCGTCTTCGTCCTCGACCAGGCCTCGCAGCTCTTCACCTTTACT
CTGCGGCCCGACTTGTTCAGGCGCCGGACGGCCGTCGACGCCAGCCTGTCAGAGCTGGGCAAGGTTCAGTCGCCG
GCGGGCTTGAGCTTCAAGACGCCGCATCGGCTGGTCGCCGTGACGTCCAACATTCTCCTAGCGACCGTCAACGAT
GGCGGCATGATTCGCTTTGACAGGAGCAAGTCTGACGATGCGACGAATGGCATGTGGAAGGAATCCTTCTTCAAC
GTCCAGGGCTGGACCCAAAACCTTCGGAGCCTGCTGCCCTTCCAGGGTAAGCACGTCGTCAGGCACGGCAGGGTC
AACATGGAATACACCGCGACAACGTCCCTCCAGGTCACTTCATTCGGTCTCGACCAAGGCCTCTTCGCCGTTACT
GTCTGTCTCGATCATCGTATGCGCATCTGGAACGTCGACGATGGCCAGATCCTCTACACAGGCGATATCCTCAAC
TCGGAGAGGCCGTCGCAAGAGGTGGGCAAATGGACCATCGATCCTTCGCAGTCGAACCTCGTCCATCTCGTCGGT
AGGCATCGGGGTCAGAGGATATGCGCCACATACTCGCCCATCGGGTCCGGCGAGTTCAAGTTCTGGAAACTCGTT
GTCAGGGATGCCCACACCATCACGGTCGAGGACCTGTTCCCCGAGAACCGCCTCTTGCCGCCGAGTCCGACCTCA
CCCGACATATGGACCATGGCCGACTTTGTCCTGGCCTCGCCATCCGAGGGCTCCATCATCCTCTGGACCCTCTGG
AAGAACAACCTGACATACAGAGTGCAGTGCCTCGAGGTCGATAGGGACAACATGGAGAGAACGTGGGAGGACGGC
TGGGACGGCGCTTTTCCCGAGCCAGTTCTCGCCGCCGTCCCGGTCTCTGACCCCTGCGACCCTACCGACGTCACC
GAGAAGTGGCTGCAGGCCATCTTCCAGCCCGGCAGGTTTACCAAGGCGACCCTAGAGACGGCCCTGTCCATCTAC
GAACGCGGGCTGGGGGCGACCCGGGATACCACCCGGGGAAGGAGCCTGGCCGAGTCCATCTGCTCCGTGCTTGGC
TCGACGGCCTCCTTGGAGCGAGGGTCCTCTGGCGCCATGGACTACGAGCTATTCCGGACCTCCAACGAGACTCAG
TGGCGGAGGTTCTATCGGTTACTTAACGAGCTGGATAAGCAGCGTGGCGAGGCCGTCGGTCTTGCCCTTGACCCG
GAGACGGACATGACTTGGGTTGTTTGCACCGACCTTGTCTCCGCCATCACAGAATGCAGCAGCCTGGAGCGTGTA
TGCCACAACCTTTCCTCGCCGGACGAAGAGCAGCAGAACCTGGCTGCCCTGGTCGGTACCGCCCTAGCCTTCGTC
GACGGCTTCCCCGACGCGTACGTGCAGCTGTCCAAGGCGGCCCTCCGGCAAGAGGTTTTCGAGCAGTCCTCCAAG
ACGGATCTGGAGCGCATCCAATACTTTTCCGACAAGGCTGCCTTTTGGCGCGGCATTACCGACGAGGATTGCGCC
CAGGTGGTCGATGCCTTGGACGCCAACTTCGGCATCGTAACCGACGGGCTTTACAGAGATGTCTTGGGCCTGGTG
GCCGCGCCGCTCGAGGCGAAGCGTCGCCACCTCCGTCATCCATTGACCGAATTCGGCAAGAAGCTCATCATGAAG
GGTGTCCAAGACTGCATTGAGCTGCAGAGGAAGGTCTGCTTCTCCCAGCTTGTGTTGCTGGTGCACATGGAGTTC
GAGTTTGACAAGGAGGATGAGGCTCTCCATCACCGAGTCGACATTGGGCTCGTCTTTCGGGAGCTCGTGAACGCG
CTCAAGAGGCTCGAGCTGCTGGACTGGCTCGCACGAACGGAGCTTTCGGTACCTCTCTTCCGGTCGGAAAAGGGA
ACCCCGGCTCCGGCGTTGAGGAAGGGCGACGGCGGCGACGAGTCGCAAGTCATCACCGCTCTCGAGGCCAACGTT
GGGCATCTTCTGGGCTTCGGCCACGCCAGGAACGAGCCGCTCTCCCTGACCATCACGGAGCTGGTGGCGAACCTC
TGCGCGCCAGACAGCGATATCGAGGTGTCGCCGACGCTGATTCAGTGCTCGCTCGTCAAACACGACAGGGCGGAT
CTGGCCCTGGCTCTGGCTCCGTTTTGCGACCAGCATCCCTTCTCCGTCTACATTAACGGGAGAGTGCTGCTGGTG
CTCAAAGATCTGGAGGCGGCGGCCATCAACTTTAGGAAAGCTGCCGTTGGGATGGGCAATGAGTTGGTCATGTCG
GATCGGCACAGCTGCGGCCTGCTCGACGACACGGAATGGAACCTGCTCAACAGCGGGCAGGCCAAGTACTACGCG
CACATCACCGCGCTATACGAAGAGCAGAGGGCGTACTCGTACGTCATGGAGTATGCCCGGCTGGCCATTCAGTTT
GCAGGTCTGAGCGGGAGCGGTGACGGCACCAAGACGGATATGCTGAGTCGGCTATTCCACGCGGCCTTGGCCATG
TCGCAGTTTGAGCTGGCCCACACGAGTCTGTTCTCGATGAAAGACGAGGCGCTGCGGCGGTCGAGCCTACGGCTG
CTCGTTGACAAGATGTGCGACACGTACCACAGCACCGAACTCGTCGCTCTACCCTTTCCCGGAATGCAGCAGGAA
GTGGACGCGATGCTGGCCCAGCGATGCAAGGCCTCGGCCGACCCGGTGCACGGTTTCCCGTACCACCAAGTGCTC
TACTCGTGGCGCATCCGGCGCAACAACTACAGGGGCGCGGCGGCGGTGCTACTGGATCGCATCCAGAGGCTGAAA
TTGGCAGGGGAGGGTGACAAGATGACGGGAGAGGACGTTCTCGACACGCCCGTGACGCGGCAGTACCTACTGCTC
ATCAACGCCCTGAGTTGCGTGGATCCGAAGCAGGCCTGGGTCTTTGAAGAGGGAGCGGCGGGCAGCAAGCGCAAC
GTCGTCTCCCTGGCAGACATCAGGAAGCAGTATCGGGACGAGCTGGACAGGATCGCGGCCATTCAGAACAACCAG
TTTGGATTCGAGGCCGACGATGATGTCATGGATATCGCG
Transcript >Ophio5|5144
ATGGAGCAACAAGACACACACTATCTCTTTAAAGAGACCCGACTGAACCTCGAGACTCCCTCGCCAGCCGTCGAA
GTCAGCATCCGCGTACCATCCAAGACGGGCGGTGCCCGTGCCCAGCAAAGACTGCTGCCAGCAAGCGATCCGTCG
GCCGACGACGAGACGACGTTCCGGCTCAAGAACCTGGCCGTCGCATCGTCCGTCTATCACAGGAAGTGGCATGAC
GCGCCGCGCAGTTTTCTATGGCGCGTCCTCGACGATGGCCGCGTGCTGAGTATCCGCGTCGTCGATCTTTGCAAG
CGCGACAAGGCGCCTGACGCGCCCCTGGTGCTACACTTCTCCTTTTCCCTACCCATACAGCCCGGGTGCGTGGCC
TTTTCCGATCCGCAGGAGCACGACGCGCTTTGCGTCTTCGTCCTCGACCAGGCCTCGCAGCTCTTCACCTTTACT
CTGCGGCCCGACTTGTTCAGGCGCCGGACGGCCGTCGACGCCAGCCTGTCAGAGCTGGGCAAGGTTCAGTCGCCG
GCGGGCTTGAGCTTCAAGACGCCGCATCGGCTGGTCGCCGTGACGTCCAACATTCTCCTAGCGACCGTCAACGAT
GGCGGCATGATTCGCTTTGACAGGAGCAAGTCTGACGATGCGACGAATGGCATGTGGAAGGAATCCTTCTTCAAC
GTCCAGGGCTGGACCCAAAACCTTCGGAGCCTGCTGCCCTTCCAGGGTAAGCACGTCGTCAGGCACGGCAGGGTC
AACATGGAATACACCGCGACAACGTCCCTCCAGGTCACTTCATTCGGTCTCGACCAAGGCCTCTTCGCCGTTACT
GTCTGTCTCGATCATCGTATGCGCATCTGGAACGTCGACGATGGCCAGATCCTCTACACAGGCGATATCCTCAAC
TCGGAGAGGCCGTCGCAAGAGGTGGGCAAATGGACCATCGATCCTTCGCAGTCGAACCTCGTCCATCTCGTCGGT
AGGCATCGGGGTCAGAGGATATGCGCCACATACTCGCCCATCGGGTCCGGCGAGTTCAAGTTCTGGAAACTCGTT
GTCAGGGATGCCCACACCATCACGGTCGAGGACCTGTTCCCCGAGAACCGCCTCTTGCCGCCGAGTCCGACCTCA
CCCGACATATGGACCATGGCCGACTTTGTCCTGGCCTCGCCATCCGAGGGCTCCATCATCCTCTGGACCCTCTGG
AAGAACAACCTGACATACAGAGTGCAGTGCCTCGAGGTCGATAGGGACAACATGGAGAGAACGTGGGAGGACGGC
TGGGACGGCGCTTTTCCCGAGCCAGTTCTCGCCGCCGTCCCGGTCTCTGACCCCTGCGACCCTACCGACGTCACC
GAGAAGTGGCTGCAGGCCATCTTCCAGCCCGGCAGGTTTACCAAGGCGACCCTAGAGACGGCCCTGTCCATCTAC
GAACGCGGGCTGGGGGCGACCCGGGATACCACCCGGGGAAGGAGCCTGGCCGAGTCCATCTGCTCCGTGCTTGGC
TCGACGGCCTCCTTGGAGCGAGGGTCCTCTGGCGCCATGGACTACGAGCTATTCCGGACCTCCAACGAGACTCAG
TGGCGGAGGTTCTATCGGTTACTTAACGAGCTGGATAAGCAGCGTGGCGAGGCCGTCGGTCTTGCCCTTGACCCG
GAGACGGACATGACTTGGGTTGTTTGCACCGACCTTGTCTCCGCCATCACAGAATGCAGCAGCCTGGAGCGTGTA
TGCCACAACCTTTCCTCGCCGGACGAAGAGCAGCAGAACCTGGCTGCCCTGGTCGGTACCGCCCTAGCCTTCGTC
GACGGCTTCCCCGACGCGTACGTGCAGCTGTCCAAGGCGGCCCTCCGGCAAGAGGTTTTCGAGCAGTCCTCCAAG
ACGGATCTGGAGCGCATCCAATACTTTTCCGACAAGGCTGCCTTTTGGCGCGGCATTACCGACGAGGATTGCGCC
CAGGTGGTCGATGCCTTGGACGCCAACTTCGGCATCGTAACCGACGGGCTTTACAGAGATGTCTTGGGCCTGGTG
GCCGCGCCGCTCGAGGCGAAGCGTCGCCACCTCCGTCATCCATTGACCGAATTCGGCAAGAAGCTCATCATGAAG
GGTGTCCAAGACTGCATTGAGCTGCAGAGGAAGGTCTGCTTCTCCCAGCTTGTGTTGCTGGTGCACATGGAGTTC
GAGTTTGACAAGGAGGATGAGGCTCTCCATCACCGAGTCGACATTGGGCTCGTCTTTCGGGAGCTCGTGAACGCG
CTCAAGAGGCTCGAGCTGCTGGACTGGCTCGCACGAACGGAGCTTTCGGTACCTCTCTTCCGGTCGGAAAAGGGA
ACCCCGGCTCCGGCGTTGAGGAAGGGCGACGGCGGCGACGAGTCGCAAGTCATCACCGCTCTCGAGGCCAACGTT
GGGCATCTTCTGGGCTTCGGCCACGCCAGGAACGAGCCGCTCTCCCTGACCATCACGGAGCTGGTGGCGAACCTC
TGCGCGCCAGACAGCGATATCGAGGTGTCGCCGACGCTGATTCAGTGCTCGCTCGTCAAACACGACAGGGCGGAT
CTGGCCCTGGCTCTGGCTCCGTTTTGCGACCAGCATCCCTTCTCCGTCTACATTAACGGGAGAGTGCTGCTGGTG
CTCAAAGATCTGGAGGCGGCGGCCATCAACTTTAGGAAAGCTGCCGTTGGGATGGGCAATGAGTTGGTCATGTCG
GATCGGCACAGCTGCGGCCTGCTCGACGACACGGAATGGAACCTGCTCAACAGCGGGCAGGCCAAGTACTACGCG
CACATCACCGCGCTATACGAAGAGCAGAGGGCGTACTCGTACGTCATGGAGTATGCCCGGCTGGCCATTCAGTTT
GCAGGTCTGAGCGGGAGCGGTGACGGCACCAAGACGGATATGCTGAGTCGGCTATTCCACGCGGCCTTGGCCATG
TCGCAGTTTGAGCTGGCCCACACGAGTCTGTTCTCGATGAAAGACGAGGCGCTGCGGCGGTCGAGCCTACGGCTG
CTCGTTGACAAGATGTGCGACACGTACCACAGCACCGAACTCGTCGCTCTACCCTTTCCCGGAATGCAGCAGGAA
GTGGACGCGATGCTGGCCCAGCGATGCAAGGCCTCGGCCGACCCGGTGCACGGTTTCCCGTACCACCAAGTGCTC
TACTCGTGGCGCATCCGGCGCAACAACTACAGGGGCGCGGCGGCGGTGCTACTGGATCGCATCCAGAGGCTGAAA
TTGGCAGGGGAGGGTGACAAGATGACGGGAGAGGACGTTCTCGACACGCCCGTGACGCGGCAGTACCTACTGCTC
ATCAACGCCCTGAGTTGCGTGGATCCGAAGCAGGCCTGGGTCTTTGAAGAGGGAGCGGCGGGCAGCAAGCGCAAC
GTCGTCTCCCTGGCAGACATCAGGAAGCAGTATCGGGACGAGCTGGACAGGATCGCGGCCATTCAGAACAACCAG
TTTGGATTCGAGGCCGACGATGATGTCATGGATATCGCGTGA
Gene >Ophio5|5144
ATGGAGCAACAAGACACACACTATCTCTTTAAAGAGACCCGACTGAACCTCGAGACTCCCTCGCCAGCCGTCGAA
GTCAGCATCCGCGTACCATCCAAGACGGGCGGTGCCCGTGCCCAGCAAAGACTGCTGCCAGCAAGCGATCCGTCG
GCCGACGACGAGACGACGTTCCGGCTCAAGAACCTGGCCGTCGCATCGTCCGTCTATCACAGGAAGTGGCATGAC
GCGCCGCGCAGTTTTCTATGGCGCGTCCTCGACGATGGCCGCGTGCTGAGTATCCGCGTCGTCGATCTTTGCAAG
CGCGACAAGGCGCCTGACGCGCCCCTGGTGCTACACTTCTCCTTTTCCCTACCCATACAGCCCGGGTGCGTGGCC
TTTTCCGATCCGCAGGAGCACGACGCGCTTTGCGTCTTCGTCCTCGACCAGGCCTCGCAGCTCTTCACCTTTACT
CTGCGGCCCGACTTGTTCAGGCGCCGGACGGCCGTCGACGCCAGCCTGTCAGAGCTGGGCAAGGTTCAGTCGCCG
GCGGGCTTGAGCTTCAAGACGCCGCATCGGCTGGTCGCCGTGACGTCCAACATTCTCCTAGCGACCGTCAACGAT
GGCGGCATGATTCGCTTTGACAGGAGCAAGTCTGACGATGGTGAGCCGCCTTCCTTCTCTTCATCAGCTTGCACG
TACGCTCAAACTAATCGAGTCCAGCGACGAATGGCATGTGGAAGGAATCCTTCTTCAACGTCCAGGGCTGGACCC
AAAACCTTCGGAGCCTGCTGCCCTTCCAGGGTAAGCACGTCGTCAGGCACGGCAGGGTCAACATGGAATACACCG
CGACAACGTCCCTCCAGGTCACTTCATTCGGTCTCGACCAAGGCCTCTTCGCCGTTACTGTCTGTCTCGATCATC
GTATGCGCATCTGGAACGTCGACGATGGCCAGATCCTCTACACAGGCGATATCCTCAACTCGGAGAGGCCGTCGC
AAGAGGTGGGCAAATGGACCATCGATCCTTCGCAGTCGAACCTCGTCCATCTCGTCGGTAGGCATCGGGGTCAGA
GGATATGCGCCACATACTCGCCCATCGGGTCCGGCGAGTTCAAGTTCTGGAAACTCGTTGTCAGGGATGCCCACA
CCATCACGGTCGAGGACCTGTTCCCCGAGAACCGCCTCTTGCCGCCGAGTCCGACCTCACCCGACATATGGACCA
TGGCCGACTTTGTCCTGGCCTCGCCATCCGAGGGCTCCATCATCCTCTGGACCCTCTGGAAGAACAACCTGACAT
ACAGAGTGCAGTGCCTCGAGGTCGATAGGGACAACATGGAGAGAACGTGGGAGGACGGCTGGGACGGCGCTTTTC
CCGAGCCAGTTCTCGCCGCCGTCCCGGTCTCTGACCCCTGCGACCCTACCGACGTCACCGAGAAGTGGCTGCAGG
CCATCTTCCAGCCCGGCAGGTTTACCAAGGCGACCCTAGAGACGGCCCTGTCCATCTACGAACGCGGGCTGGGGG
CGACCCGGGATACCACCCGGGGAAGGAGCCTGGCCGAGTCCATCTGCTCCGTGCTTGGCTCGACGGCCTCCTTGG
AGCGAGGGTCCTCTGGCGCCATGGACTACGAGCTATTCCGGACCTCCAACGAGACTCAGTGGCGGAGGTTCTATC
GGTTACTTAACGAGCTGGATAAGCAGCGTGGCGAGGCCGTCGGTCTTGCCCTTGACCCGGAGACGGACATGACTT
GGGTTGTTTGCACCGACCTTGTCTCCGCCATCACAGAATGCAGCAGCCTGGAGCGTGTATGCCACAACCTTTCCT
CGCCGGACGAAGAGCAGCAGAACCTGGCTGCCCTGGTCGGTACCGCCCTAGCCTTCGTCGACGGCTTCCCCGACG
CGTACGTGCAGCTGTCCAAGGCGGCCCTCCGGCAAGAGGTTTTCGAGCAGTCCTCCAAGACGGATCTGGAGCGCA
TCCAATACTTTTCCGACAAGGCTGCCTTTTGGCGCGGCATTACCGACGAGGATTGCGCCCAGGTGGTCGATGCCT
TGGACGCCAACTTCGGCATCGTAACCGACGGGCTTTACAGAGATGTCTTGGGCCTGGTGGCCGCGCCGCTCGAGG
CGAAGCGTCGCCACCTCCGTCATCCATTGACCGAATTCGGCAAGAAGCTCATCATGAAGGGTGTCCAAGACTGCA
TTGAGCTGCAGAGGAAGGTCTGCTTCTCCCAGCTTGTGTTGCTGGTGCACATGGAGTTCGAGTTTGACAAGGAGG
ATGAGGCTCTCCATCACCGAGTCGACATTGGGCTCGTCTTTCGGGAGCTCGTGAACGCGCTCAAGAGGCTCGAGC
TGCTGGACTGGCTCGCACGAACGGAGCTTTCGGTACCTCTCTTCCGGTCGGAAAAGGGAACCCCGGCTCCGGCGT
TGAGGAAGGGCGACGGCGGCGACGAGTCGCAAGTCATCACCGCTCTCGAGGCCAACGTTGGGCATCTTCTGGGCT
TCGGCCACGCCAGGAACGAGCCGCTCTCCCTGACCATCACGGAGCTGGTGGCGAACCTCTGCGCGCCAGACAGCG
ATATCGAGGTGTCGCCGACGCTGATTCAGTGCTCGCTCGTCAAACACGACAGGGCGGATCTGGCCCTGGCTCTGG
CTCCGTTTTGCGACCAGCATCCCTTCTCCGTCTACATTAACGGGAGAGTGCTGCTGGTGCTCAAAGATCTGGAGG
CGGCGGCCATCAACTTTAGGAAAGCTGCCGTTGGGATGGGTAAGGACGTGCAGCGTTCTCGGGGCGAAGATGTTG
AAGCTGACGTGCGGCCAGGCAATGAGTTGGTCATGTCGGATCGGCACAGCTGCGGCCTGCTCGACGACACGGAAT
GGAACCTGCTCAACAGCGGGCAGGCCAAGTACTACGCGCACATCACCGCGCTATACGAAGAGCAGAGGGCGTACT
CGTACGTCATGGAGTATGCCCGGCTGGCCATTCAGTTTGCAGGTCTGAGCGGGAGCGGTGACGGCACCAAGACGG
ATATGCTGAGTCGGCTATTCCACGCGGCCTTGGCCATGTCGCAGTTTGAGCTGGCCCACACGAGTCTGTTCTCGA
TGAAAGACGAGGCGCTGCGGCGGTCGAGCCTACGGCTGCTCGTTGACAAGATGTGCGACACGTACCACAGCACCG
AACTCGTCGCTCTACCCTTTCCCGGAATGCAGCAGGAAGTGGACGCGATGCTGGCCCAGCGATGCAAGGCCTCGG
CCGACCCGGTGCACGGTTTCCCGTACCACCAAGTGCTCTACTCGTGGCGCATCCGGCGCAACAACTACAGGGGCG
CGGCGGCGGTGCTACTGGATCGCATCCAGAGGCTGAAATTGGCAGGGGAGGGTGACAAGATGACGGGAGAGGACG
TTCTCGACACGCCCGTGACGCGGCAGTACCTACTGCTCATCAACGCCCTGAGTTGCGTGGATCCGAAGCAGGCCT
GGGTCTTTGAAGAGGGAGCGGCGGGCAGCAAGCGCAACGTCGTCTCCCTGGCAGACATCAGGAAGCAGTATCGGG
ACGAGCTGGACAGGATCGCGGCCATTCAGAACAACCAGTTTGGATTCGAGGCCGACGATGATGTCATGGATATCG
CGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail