Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5140
Gene name
Locationscaffold_413:2144..3279
Strand+
Gene length (bp)1135
Transcript length (bp)1080
Coding sequence length (bp)1077
Protein length (aa) 359

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04146 YTH YT521-B-like domain 1.1E-67 130 329

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0DA50|C3H45_ORYSJ Zinc finger CCCH domain-containing protein 45 OS=Oryza sativa subsp. japonica GN=Os06g0677700 PE=3 SV=1 130 193 4.0E-13
sp|A9LNK9|CPSF_ARATH 30-kDa cleavage and polyadenylation specificity factor 30 OS=Arabidopsis thaliana GN=CPSF30 PE=1 SV=1 128 193 2.0E-12
sp|Q5R746|YTDC2_PONAB YTH domain-containing protein 2 OS=Pongo abelii GN=YTHDC2 PE=2 SV=1 242 331 5.0E-11
sp|A9LNK9|CPSF_ARATH 30-kDa cleavage and polyadenylation specificity factor 30 OS=Arabidopsis thaliana GN=CPSF30 PE=1 SV=1 269 328 7.0E-11
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 242 331 7.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0DA50|C3H45_ORYSJ Zinc finger CCCH domain-containing protein 45 OS=Oryza sativa subsp. japonica GN=Os06g0677700 PE=3 SV=1 130 193 4.0E-13
sp|A9LNK9|CPSF_ARATH 30-kDa cleavage and polyadenylation specificity factor 30 OS=Arabidopsis thaliana GN=CPSF30 PE=1 SV=1 128 193 2.0E-12
sp|Q5R746|YTDC2_PONAB YTH domain-containing protein 2 OS=Pongo abelii GN=YTHDC2 PE=2 SV=1 242 331 5.0E-11
sp|A9LNK9|CPSF_ARATH 30-kDa cleavage and polyadenylation specificity factor 30 OS=Arabidopsis thaliana GN=CPSF30 PE=1 SV=1 269 328 7.0E-11
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 242 331 7.0E-11
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 242 331 2.0E-10
sp|Q5R746|YTDC2_PONAB YTH domain-containing protein 2 OS=Pongo abelii GN=YTHDC2 PE=2 SV=1 130 193 4.0E-10
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 130 193 1.0E-09
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 130 193 2.0E-09
sp|Q96MU7|YTDC1_HUMAN YTH domain-containing protein 1 OS=Homo sapiens GN=YTHDC1 PE=1 SV=3 127 192 9.0E-09
sp|Q9QY02|YTDC1_RAT YTH domain-containing protein 1 OS=Rattus norvegicus GN=Ythdc1 PE=1 SV=2 127 192 9.0E-09
sp|Q0DA50|C3H45_ORYSJ Zinc finger CCCH domain-containing protein 45 OS=Oryza sativa subsp. japonica GN=Os06g0677700 PE=3 SV=1 272 328 1.0E-08
sp|E9Q5K9|YTDC1_MOUSE YTH domain-containing protein 1 OS=Mus musculus GN=Ythdc1 PE=1 SV=2 127 192 1.0E-08
sp|P59326|YTHD1_MOUSE YTH domain-containing family protein 1 OS=Mus musculus GN=Ythdf1 PE=1 SV=1 123 201 2.0E-07
sp|Q9QY02|YTDC1_RAT YTH domain-containing protein 1 OS=Rattus norvegicus GN=Ythdc1 PE=1 SV=2 273 328 2.0E-07
sp|Q9Y5A9|YTHD2_HUMAN YTH domain-containing family protein 2 OS=Homo sapiens GN=YTHDF2 PE=1 SV=2 123 201 2.0E-07
sp|Q4R5D9|YTHD2_MACFA YTH domain-containing family protein 2 OS=Macaca fascicularis GN=YTHDF2 PE=2 SV=1 123 201 2.0E-07
sp|Q0VCZ3|YTHD2_BOVIN YTH domain-containing family protein 2 OS=Bos taurus GN=YTHDF2 PE=2 SV=1 123 201 2.0E-07
sp|Q91YT7|YTHD2_MOUSE YTH domain-containing family protein 2 OS=Mus musculus GN=Ythdf2 PE=1 SV=1 123 201 2.0E-07
sp|E9Q5K9|YTDC1_MOUSE YTH domain-containing protein 1 OS=Mus musculus GN=Ythdc1 PE=1 SV=2 273 328 2.0E-07
sp|Q96MU7|YTDC1_HUMAN YTH domain-containing protein 1 OS=Homo sapiens GN=YTHDC1 PE=1 SV=3 273 328 2.0E-07
sp|Q9BYJ9|YTHD1_HUMAN YTH domain-containing family protein 1 OS=Homo sapiens GN=YTHDF1 PE=1 SV=1 125 201 4.0E-07
sp|Q5RFL8|YTHD3_PONAB YTH domain-containing family protein 3 OS=Pongo abelii GN=YTHDF3 PE=2 SV=1 123 201 8.0E-07
sp|Q7Z739|YTHD3_HUMAN YTH domain-containing family protein 3 OS=Homo sapiens GN=YTHDF3 PE=1 SV=1 123 201 8.0E-07
sp|Q8BYK6|YTHD3_MOUSE YTH domain-containing family protein 3 OS=Mus musculus GN=Ythdf3 PE=1 SV=2 123 201 8.0E-07
sp|Q06390|MRB1_YEAST Methylated RNA-binding protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO92 PE=1 SV=1 126 201 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5140
MSLVHHVCKETAGLESLFLISKSNCAFANFKDESTCLAAQQKLHDSKFQSVRLVSRLRKNTVEGATGLTAPTGPA
ANTASTAVQNEAAHDSPGLDNRSPGSDARSPSPAASQAAKPKASSGGDGNPQTDKFFILKSLTMEDLELSVRTGI
WATQSHNEESLNTAFKNFDNVFLIFSANKSGEYFGYARMVSEINDDPAAAIEFAPKSQSTSNLDLPKAIPTDATE
FAPKGRIIDDSARGTIFWEAEREDSESGSDNASEVSSNRSIGTEEETKTWGKPFKLEWLSISRLPFYRTRGLRNP
WNSNREVKIARDGTELEPSVGRRLIGLFNRVQSPGPVAPAMRLPPPMMHGYVPIRGPGQ
Coding >Ophio5|5140
ATGAGCCTTGTGCACCATGTTTGCAAAGAGACGGCTGGCCTCGAATCTCTATTTCTGATATCGAAAAGTAATTGT
GCCTTTGCAAATTTCAAAGACGAAAGCACATGCTTGGCGGCACAGCAGAAGTTACACGACTCCAAGTTTCAGTCT
GTCCGTTTAGTCAGTCGTCTGCGAAAGAACACTGTCGAGGGGGCCACGGGTCTGACGGCGCCGACCGGTCCGGCG
GCCAACACCGCGAGCACGGCAGTCCAGAACGAAGCAGCTCATGACAGCCCAGGCTTGGACAACCGCAGCCCGGGA
TCGGATGCTCGTAGTCCGAGCCCGGCTGCCAGTCAGGCAGCCAAGCCTAAAGCAAGTTCAGGAGGCGACGGGAAC
CCTCAGACTGACAAATTTTTCATCCTGAAGAGCTTAACTATGGAAGACCTCGAGCTGAGCGTGCGGACCGGAATC
TGGGCTACCCAATCCCACAACGAGGAGTCCCTCAACACGGCCTTCAAGAACTTCGACAACGTCTTCCTGATATTT
TCCGCGAATAAGTCAGGGGAGTACTTTGGGTACGCCCGCATGGTATCCGAGATTAACGACGACCCGGCGGCAGCT
ATTGAGTTTGCCCCGAAATCGCAGTCGACGAGCAATCTCGACTTGCCCAAGGCGATCCCTACGGACGCGACCGAG
TTTGCCCCCAAGGGCAGGATCATTGATGACTCCGCTCGGGGGACCATCTTCTGGGAGGCCGAGCGGGAAGACTCG
GAAAGCGGATCGGACAATGCGAGCGAGGTGTCTAGCAATAGAAGCATAGGCACGGAGGAGGAGACCAAAACCTGG
GGCAAGCCGTTCAAACTCGAATGGCTGTCCATCAGCCGGTTACCCTTCTACCGGACACGAGGCTTACGGAACCCA
TGGAATTCAAACAGGGAAGTCAAGATTGCCAGAGACGGAACCGAGCTGGAGCCGTCAGTGGGCCGGAGACTCATT
GGGCTATTCAACCGCGTCCAGAGTCCCGGACCGGTGGCGCCGGCAATGCGTCTGCCACCGCCCATGATGCATGGC
TACGTTCCTATCAGAGGGCCCGGCCAA
Transcript >Ophio5|5140
ATGAGCCTTGTGCACCATGTTTGCAAAGAGACGGCTGGCCTCGAATCTCTATTTCTGATATCGAAAAGTAATTGT
GCCTTTGCAAATTTCAAAGACGAAAGCACATGCTTGGCGGCACAGCAGAAGTTACACGACTCCAAGTTTCAGTCT
GTCCGTTTAGTCAGTCGTCTGCGAAAGAACACTGTCGAGGGGGCCACGGGTCTGACGGCGCCGACCGGTCCGGCG
GCCAACACCGCGAGCACGGCAGTCCAGAACGAAGCAGCTCATGACAGCCCAGGCTTGGACAACCGCAGCCCGGGA
TCGGATGCTCGTAGTCCGAGCCCGGCTGCCAGTCAGGCAGCCAAGCCTAAAGCAAGTTCAGGAGGCGACGGGAAC
CCTCAGACTGACAAATTTTTCATCCTGAAGAGCTTAACTATGGAAGACCTCGAGCTGAGCGTGCGGACCGGAATC
TGGGCTACCCAATCCCACAACGAGGAGTCCCTCAACACGGCCTTCAAGAACTTCGACAACGTCTTCCTGATATTT
TCCGCGAATAAGTCAGGGGAGTACTTTGGGTACGCCCGCATGGTATCCGAGATTAACGACGACCCGGCGGCAGCT
ATTGAGTTTGCCCCGAAATCGCAGTCGACGAGCAATCTCGACTTGCCCAAGGCGATCCCTACGGACGCGACCGAG
TTTGCCCCCAAGGGCAGGATCATTGATGACTCCGCTCGGGGGACCATCTTCTGGGAGGCCGAGCGGGAAGACTCG
GAAAGCGGATCGGACAATGCGAGCGAGGTGTCTAGCAATAGAAGCATAGGCACGGAGGAGGAGACCAAAACCTGG
GGCAAGCCGTTCAAACTCGAATGGCTGTCCATCAGCCGGTTACCCTTCTACCGGACACGAGGCTTACGGAACCCA
TGGAATTCAAACAGGGAAGTCAAGATTGCCAGAGACGGAACCGAGCTGGAGCCGTCAGTGGGCCGGAGACTCATT
GGGCTATTCAACCGCGTCCAGAGTCCCGGACCGGTGGCGCCGGCAATGCGTCTGCCACCGCCCATGATGCATGGC
TACGTTCCTATCAGAGGGCCCGGCCAATAG
Gene >Ophio5|5140
ATGAGCCTTGTGCACCATGTTTGCAAAGAGACGGCTGGCCTCGAATCTCTATTTCTGATATCGAAAAGTAATTGT
GCCTTTGCAAATTTCAAAGACGAAAGCACATGCTTGGCGGCACAGCAGAAGTTACACGACTCCAAGTTTCAGTCT
GTCCGTTTAGTCAGTCGTCTGCGAAAGAACACTGTCGAGGGGGCCACGGGTCTGACGGCGCCGACCGGTCCGGCG
GCCAACACCGCGAGCACGGCAGTCCAGAACGAAGCAGCTCATGACAGCCCAGGCTTGGACAACCGCAGCCCGGGA
TCGGATGCTCGTAGTCCGAGCCCGGCTGCCAGTCAGGCAGCCAAGCCTAAAGCAAGTTCAGGAGGCGACGGGAAC
CCTCAGACTGACAAATTTTTCATCCTGAAGAGCTTAACTATGGAAGACCTCGAGCTGAGCGTGCGGACCGGAATC
TGGGCTACCCAATCCCACAACGAGGAGTCCCTCAACACGGCCTTCAAGGTTGGGGTGCCAGCCAGGGGCAAAAGT
TGCGAACACTTGGCTAACTTAACAGCAGAACTTCGACAACGTCTTCCTGATATTTTCCGCGAATAAGTCAGGGGA
GTACTTTGGGTACGCCCGCATGGTATCCGAGATTAACGACGACCCGGCGGCAGCTATTGAGTTTGCCCCGAAATC
GCAGTCGACGAGCAATCTCGACTTGCCCAAGGCGATCCCTACGGACGCGACCGAGTTTGCCCCCAAGGGCAGGAT
CATTGATGACTCCGCTCGGGGGACCATCTTCTGGGAGGCCGAGCGGGAAGACTCGGAAAGCGGATCGGACAATGC
GAGCGAGGTGTCTAGCAATAGAAGCATAGGCACGGAGGAGGAGACCAAAACCTGGGGCAAGCCGTTCAAACTCGA
ATGGCTGTCCATCAGCCGGTTACCCTTCTACCGGACACGAGGCTTACGGAACCCATGGAATTCAAACAGGGAAGT
CAAGATTGCCAGAGACGGAACCGAGCTGGAGCCGTCAGTGGGCCGGAGACTCATTGGGCTATTCAACCGCGTCCA
GAGTCCCGGACCGGTGGCGCCGGCAATGCGTCTGCCACCGCCCATGATGCATGGCTACGTTCCTATCAGAGGGCC
CGGCCAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail