Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5127
Gene name
Locationscaffold_411:10633..11274
Strand-
Gene length (bp)641
Transcript length (bp)453
Coding sequence length (bp)450
Protein length (aa) 150

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08570 DUF1761 Protein of unknown function (DUF1761) 6.4E-24 13 139

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UTI9|YKZ2_SCHPO UPF0591 membrane protein C15E1.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC15E1.02c PE=3 SV=1 2 145 3.0E-22

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 58 80 22
3 90 112 22
4 121 143 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 1573.38 727.97 2418.78
CcL In ants, during behavior modification 323.16 160.83 485.49
CcD In ants, recently dead 144.28 72.97 215.60

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5127
MSLHYLPPVKPSAIAVGLAFSQSVELAVLAPIFGQTYQRAKAASTKEEFLRSREAAGAASAWGTSFVGAAMQAYG
VAALINATGTLSYKGAAYLGGLIFTATAVPTYMAQVFTEKRPLDTVGVSVAAKLCETIGLSVFLTWWGTRTNPFD
Coding >Ophio5|5127
ATGTCTCTGCACTACCTCCCCCCCGTCAAGCCTTCGGCCATCGCCGTCGGCCTCGCCTTCAGCCAGAGCGTTGAG
CTCGCTGTCCTGGCTCCCATTTTCGGCCAGACTTACCAGCGCGCCAAGGCGGCCAGCACCAAGGAAGAGTTCCTC
CGCTCGCGTGAGGCTGCCGGTGCCGCTTCGGCTTGGGGCACCAGCTTCGTCGGTGCTGCTATGCAGGCTTACGGC
GTTGCCGCCCTCATCAACGCTACCGGCACTTTGAGCTACAAGGGCGCTGCTTACCTTGGCGGGCTCATCTTTACT
GCTACGGCTGTGCCTACTTATATGGCTCAGGTGTTTACGGAGAAGAGACCCCTCGACACCGTTGGCGTCAGCGTC
GCGGCCAAGCTTTGTGAGACGATTGGCTTGTCTGTCTTCTTGACCTGGTGGGGGACGCGTACCAACCCCTTCGAC
Transcript >Ophio5|5127
ATGTCTCTGCACTACCTCCCCCCCGTCAAGCCTTCGGCCATCGCCGTCGGCCTCGCCTTCAGCCAGAGCGTTGAG
CTCGCTGTCCTGGCTCCCATTTTCGGCCAGACTTACCAGCGCGCCAAGGCGGCCAGCACCAAGGAAGAGTTCCTC
CGCTCGCGTGAGGCTGCCGGTGCCGCTTCGGCTTGGGGCACCAGCTTCGTCGGTGCTGCTATGCAGGCTTACGGC
GTTGCCGCCCTCATCAACGCTACCGGCACTTTGAGCTACAAGGGCGCTGCTTACCTTGGCGGGCTCATCTTTACT
GCTACGGCTGTGCCTACTTATATGGCTCAGGTGTTTACGGAGAAGAGACCCCTCGACACCGTTGGCGTCAGCGTC
GCGGCCAAGCTTTGTGAGACGATTGGCTTGTCTGTCTTCTTGACCTGGTGGGGGACGCGTACCAACCCCTTCGAC
TGA
Gene >Ophio5|5127
ATGTCTCTGCACTGTAAGTCGAGCAATGTTCTCTGCTGTCAAGCTCGCCTCCCGGGTGATAGCGACCGCTCTCTG
ACGAGTCAACGTTGGCAAAAAAAAAAAAAAAAAGACCTCCCCCCCGTCAAGCCTTCGGCCATCGCCGTCGGCCTC
GCCTTCAGCCAGAGCGTTGAGCTCGCTGTCCTGGCTCCCATTTTCGGCCAGACTTACCAGCGCGCCAAGGCGGCC
AGCACCAAGGAAGAGTTCCTCCGCTCGCGTGAGGCTGCCGGTGCCGCTTCGGCTTGGGGCACCAGCTTCGTCGGT
GCTGCTATGCAGGCTTACGGCGTTGCCGCCCTCATCAACGCTACCGGCACTTTGAGCTACAAGGGCGCTGCTTAC
CTTGGCGGGCTCATCTTTACTGCTACGGCTGTGCCTACTGTGCGTCGAGAAACCCTTTTTTTTTTTCCGCCTTTG
TTGGGCTTGGCTTGCCCATCGTTTCACCCCTTCTAACTGACGTCGTTGCTATTCAGTATATGGCTCAGGTGTTTA
CGGAGAAGAGACCCCTCGACACCGTTGGCGTCAGCGTCGCGGCCAAGCTTTGTGAGACGATTGGCTTGTCTGTCT
TCTTGACCTGGTGGGGGACGCGTACCAACCCCTTCGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail