Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|512
Gene name
Locationscaffold_112:31519..33896
Strand+
Gene length (bp)2377
Transcript length (bp)1506
Coding sequence length (bp)1503
Protein length (aa) 501

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00098 zf-CCHC Zinc knuckle 6.1E-08 92 107
PF00098 zf-CCHC Zinc knuckle 2.9E-06 113 129
PF00098 zf-CCHC Zinc knuckle 1.1E-04 284 299
PF00098 zf-CCHC Zinc knuckle 5.1E-06 311 327
PF00098 zf-CCHC Zinc knuckle 3.9E-04 334 348
PF00098 zf-CCHC Zinc knuckle 8.0E-08 358 374
PF00098 zf-CCHC Zinc knuckle 5.0E-07 378 395
PF00098 zf-CCHC Zinc knuckle 4.9E-06 403 419
PF14392 zf-CCHC_4 Zinc knuckle 3.4E-02 92 107
PF14392 zf-CCHC_4 Zinc knuckle 1.1E+00 132 149
PF14392 zf-CCHC_4 Zinc knuckle 8.2E-02 281 298
PF14392 zf-CCHC_4 Zinc knuckle 1.1E+00 310 326
PF14392 zf-CCHC_4 Zinc knuckle 2.2E+00 334 349
PF14392 zf-CCHC_4 Zinc knuckle 5.8E+00 379 394

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 284 399 3.0E-22
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 267 453 8.0E-20
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 284 448 3.0E-19
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 283 419 8.0E-19
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 311 441 3.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 284 399 3.0E-22
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 267 453 8.0E-20
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 284 448 3.0E-19
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 283 419 8.0E-19
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 311 441 3.0E-18
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 311 441 3.0E-18
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 311 441 3.0E-18
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 311 441 3.0E-18
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 311 441 3.0E-18
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 284 419 5.0E-18
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 311 441 6.0E-18
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 283 417 8.0E-18
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 283 417 9.0E-18
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 283 417 2.0E-17
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 283 417 2.0E-17
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 283 417 2.0E-17
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 283 417 2.0E-17
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 308 443 5.0E-17
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 284 443 2.0E-16
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 312 442 2.0E-16
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 92 375 3.0E-16
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 334 447 8.0E-16
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 282 420 3.0E-15
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 280 441 4.0E-15
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 284 418 1.0E-14
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 311 421 1.0E-14
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 312 443 2.0E-14
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 359 445 1.0E-13
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 276 374 6.0E-13
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 335 443 7.0E-13
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 108 393 1.0E-12
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 377 444 2.0E-12
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 312 445 3.0E-12
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 312 445 3.0E-12
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 312 445 3.0E-12
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 281 395 7.0E-12
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 334 431 5.0E-11
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 284 375 8.0E-11
sp|Q94C69|CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 284 417 9.0E-11
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 284 397 1.0E-10
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 329 443 2.0E-10
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 354 456 4.0E-10
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 354 456 1.0E-09
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 283 377 2.0E-09
sp|Q94C69|CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 284 418 3.0E-09
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 359 448 5.0E-09
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 335 445 6.0E-09
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 354 456 7.0E-09
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 354 456 8.0E-09
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 354 456 8.0E-09
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 354 456 8.0E-09
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 356 443 1.0E-08
sp|Q9HFF2|YL92_SCHPO Uncharacterized protein C683.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC683.02c PE=3 SV=1 312 402 2.0E-08
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 284 378 4.0E-08
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 334 418 6.0E-08
sp|A1L2T6|ZCHC7_XENLA Zinc finger CCHC domain-containing protein 7 OS=Xenopus laevis GN=zcchc7 PE=2 SV=2 326 451 6.0E-08
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 92 163 1.0E-07
sp|P05895|POL_SIVVT Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM TYO-1) GN=gag-pol PE=3 SV=2 308 376 1.0E-07
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 92 152 1.0E-07
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 92 152 1.0E-07
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 92 152 1.0E-07
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 92 152 1.0E-07
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 312 396 2.0E-07
sp|Q8N567|ZCHC9_HUMAN Zinc finger CCHC domain-containing protein 9 OS=Homo sapiens GN=ZCCHC9 PE=2 SV=2 310 403 2.0E-07
sp|P34689|GLH1_CAEEL ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans GN=glh-1 PE=1 SV=3 312 396 3.0E-07
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 378 441 4.0E-07
sp|Q8R1J3|ZCHC9_MOUSE Zinc finger CCHC domain-containing protein 9 OS=Mus musculus GN=Zcchc9 PE=2 SV=2 266 403 4.0E-07
sp|Q9P795|AIR1_SCHPO Protein air1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=air1 PE=1 SV=2 283 396 4.0E-07
sp|Q9P795|AIR1_SCHPO Protein air1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=air1 PE=1 SV=2 333 418 4.0E-07
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 93 152 5.0E-07
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 82 150 5.0E-07
sp|P27980|POL_SIVVG Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM3) GN=gag-pol PE=3 SV=2 308 376 6.0E-07
sp|A1L2T6|ZCHC7_XENLA Zinc finger CCHC domain-containing protein 7 OS=Xenopus laevis GN=zcchc7 PE=2 SV=2 270 419 7.0E-07
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 93 152 1.0E-06
sp|Q8NIW7|BBP_NEUCR Branchpoint-bridging protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bbp-1 PE=3 SV=1 215 373 1.0E-06
sp|P27973|POL_SIVV1 Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM155) GN=gag-pol PE=3 SV=2 93 127 2.0E-06
sp|P27972|GAG_SIVV1 Gag polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM155) GN=gag PE=3 SV=1 93 127 2.0E-06
sp|Q4WXV6|BBP_ASPFU Branchpoint-bridging protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bbp PE=3 SV=1 232 373 2.0E-06
sp|Q12476|AIR2_YEAST Protein AIR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIR2 PE=1 SV=1 271 397 3.0E-06
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 63 155 3.0E-06
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 63 155 3.0E-06
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 93 148 3.0E-06
sp|Q94C69|CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 335 441 5.0E-06
sp|Q12476|AIR2_YEAST Protein AIR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIR2 PE=1 SV=1 358 441 5.0E-06
sp|P27978|GAG_SIVVG Gag polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM3) GN=gag PE=3 SV=1 93 127 5.0E-06
sp|P05887|GAG_HV1C4 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate CDC-451) GN=gag PE=3 SV=3 264 400 5.0E-06
sp|P05895|POL_SIVVT Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM TYO-1) GN=gag-pol PE=3 SV=2 93 127 6.0E-06
sp|P27980|POL_SIVVG Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM3) GN=gag-pol PE=3 SV=2 93 127 6.0E-06
sp|Q4WXV6|BBP_ASPFU Branchpoint-bridging protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bbp PE=3 SV=1 92 130 6.0E-06
sp|P05895|POL_SIVVT Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM TYO-1) GN=gag-pol PE=3 SV=2 357 446 7.0E-06
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 93 152 7.0E-06
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 92 152 7.0E-06
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 312 373 8.0E-06
sp|P40507|AIR1_YEAST Protein AIR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIR1 PE=1 SV=1 284 419 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0008270 zinc ion binding Yes
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|512
MQLPESLPGEDWESSGGLDASGRQNALRLALWPARKIKTLHFNRNAFHRCIFSSMFWDNPSTAADADATEANGGH
DSSRGPDMAENGAGTGACYNCGEIGHRAADCPTPREVTCRYCNQPGHMVKDCPEKPAMMCENCGEEGHTKNRCEN
ARKINRDHVATLSPDDAWAKIKRAVAERDMDDVKEAVQEYVKALEGAVTYRDLQEGLINEGINLFIIGIERPLAP
VFTNMDLQGNMGKKFSISFRFSEKPDRPREAEAFPKSRDELLARLEDAGEVVNNGRSLCHNCGELGHVAKYCTQE
RVDKPEGPKITCTNCGEDGHRLRDCPQPRVDRFACRNCGKSGHKATDCEEPANLDNVECRKCGETGHFSRDCPQA
GPRGCRNCGQEGHIAKDCDQPRNMDNVICRNCEKTGHVSRDCPEPKDWSKVQCSNCQQYGHTKVRCQQPPAESEA
FQDGGFDAAADNAGEPVNDTWGNSGAPATAANVAASGPRKEAMCVGLGPTD
Coding >Ophio5|512
ATGCAGCTGCCTGAATCTCTGCCTGGCGAGGATTGGGAAAGCTCCGGTGGCCTTGACGCCTCAGGCCGCCAGAAC
GCCCTACGGCTTGCACTGTGGCCGGCTCGGAAAATTAAAACCTTGCACTTCAACCGAAACGCCTTCCATCGTTGC
ATTTTTTCCAGCATGTTCTGGGACAACCCGTCCACGGCGGCGGACGCCGATGCCACTGAGGCCAACGGTGGGCAT
GATTCTTCCCGAGGCCCCGACATGGCCGAGAACGGTGCTGGGACGGGTGCATGCTACAACTGTGGCGAGATCGGA
CATAGGGCCGCCGACTGCCCAACTCCTCGGGAGGTAACTTGTCGGTACTGCAATCAGCCCGGCCACATGGTCAAG
GATTGCCCTGAGAAGCCAGCCATGATGTGTGAGAATTGTGGCGAAGAAGGTCACACGAAGAACAGGTGTGAGAAC
GCCCGAAAGATCAATCGTGATCATGTTGCCACGCTGTCCCCGGACGATGCCTGGGCCAAGATCAAGCGCGCCGTC
GCTGAGCGGGACATGGACGACGTCAAGGAAGCTGTTCAAGAGTATGTTAAGGCTCTTGAAGGCGCCGTGACTTAC
CGAGACCTTCAGGAGGGCTTAATCAATGAGGGTATCAACCTCTTCATCATCGGCATCGAGCGGCCCCTCGCCCCG
GTCTTCACCAACATGGACTTACAGGGGAACATGGGCAAGAAGTTCAGTATCTCCTTCCGCTTTTCCGAGAAACCC
GATCGTCCTCGTGAGGCTGAGGCGTTTCCAAAGAGTCGCGACGAGCTACTGGCTCGCCTCGAAGACGCCGGCGAG
GTCGTCAACAACGGGCGCTCGCTCTGCCACAACTGCGGAGAATTGGGACACGTTGCGAAATATTGCACCCAGGAA
AGGGTGGACAAGCCCGAGGGACCTAAGATTACGTGCACAAATTGCGGAGAGGATGGCCATCGTCTTCGGGATTGT
CCCCAGCCAAGGGTGGACAGATTTGCCTGCCGCAACTGCGGCAAATCCGGCCACAAGGCGACGGACTGTGAGGAG
CCTGCCAACCTTGACAACGTCGAGTGCCGCAAATGCGGCGAAACGGGACACTTCTCTCGAGATTGTCCTCAGGCC
GGCCCTCGAGGCTGTCGCAACTGCGGCCAGGAAGGCCACATCGCAAAAGATTGCGACCAGCCAAGAAACATGGAC
AATGTCATCTGTCGCAACTGCGAAAAGACAGGCCACGTGAGCCGAGACTGCCCGGAGCCGAAAGACTGGAGCAAG
GTCCAGTGCAGCAATTGCCAGCAGTACGGCCACACCAAGGTCCGCTGCCAGCAGCCGCCGGCGGAATCCGAGGCT
TTCCAGGACGGGGGATTCGACGCCGCCGCAGACAATGCCGGTGAACCCGTCAACGACACATGGGGAAACTCAGGT
GCTCCAGCGACCGCGGCGAACGTGGCGGCTTCTGGTCCCCGAAAAGAGGCCATGTGTGTCGGGCTCGGGCCTACG
GAT
Transcript >Ophio5|512
ATGCAGCTGCCTGAATCTCTGCCTGGCGAGGATTGGGAAAGCTCCGGTGGCCTTGACGCCTCAGGCCGCCAGAAC
GCCCTACGGCTTGCACTGTGGCCGGCTCGGAAAATTAAAACCTTGCACTTCAACCGAAACGCCTTCCATCGTTGC
ATTTTTTCCAGCATGTTCTGGGACAACCCGTCCACGGCGGCGGACGCCGATGCCACTGAGGCCAACGGTGGGCAT
GATTCTTCCCGAGGCCCCGACATGGCCGAGAACGGTGCTGGGACGGGTGCATGCTACAACTGTGGCGAGATCGGA
CATAGGGCCGCCGACTGCCCAACTCCTCGGGAGGTAACTTGTCGGTACTGCAATCAGCCCGGCCACATGGTCAAG
GATTGCCCTGAGAAGCCAGCCATGATGTGTGAGAATTGTGGCGAAGAAGGTCACACGAAGAACAGGTGTGAGAAC
GCCCGAAAGATCAATCGTGATCATGTTGCCACGCTGTCCCCGGACGATGCCTGGGCCAAGATCAAGCGCGCCGTC
GCTGAGCGGGACATGGACGACGTCAAGGAAGCTGTTCAAGAGTATGTTAAGGCTCTTGAAGGCGCCGTGACTTAC
CGAGACCTTCAGGAGGGCTTAATCAATGAGGGTATCAACCTCTTCATCATCGGCATCGAGCGGCCCCTCGCCCCG
GTCTTCACCAACATGGACTTACAGGGGAACATGGGCAAGAAGTTCAGTATCTCCTTCCGCTTTTCCGAGAAACCC
GATCGTCCTCGTGAGGCTGAGGCGTTTCCAAAGAGTCGCGACGAGCTACTGGCTCGCCTCGAAGACGCCGGCGAG
GTCGTCAACAACGGGCGCTCGCTCTGCCACAACTGCGGAGAATTGGGACACGTTGCGAAATATTGCACCCAGGAA
AGGGTGGACAAGCCCGAGGGACCTAAGATTACGTGCACAAATTGCGGAGAGGATGGCCATCGTCTTCGGGATTGT
CCCCAGCCAAGGGTGGACAGATTTGCCTGCCGCAACTGCGGCAAATCCGGCCACAAGGCGACGGACTGTGAGGAG
CCTGCCAACCTTGACAACGTCGAGTGCCGCAAATGCGGCGAAACGGGACACTTCTCTCGAGATTGTCCTCAGGCC
GGCCCTCGAGGCTGTCGCAACTGCGGCCAGGAAGGCCACATCGCAAAAGATTGCGACCAGCCAAGAAACATGGAC
AATGTCATCTGTCGCAACTGCGAAAAGACAGGCCACGTGAGCCGAGACTGCCCGGAGCCGAAAGACTGGAGCAAG
GTCCAGTGCAGCAATTGCCAGCAGTACGGCCACACCAAGGTCCGCTGCCAGCAGCCGCCGGCGGAATCCGAGGCT
TTCCAGGACGGGGGATTCGACGCCGCCGCAGACAATGCCGGTGAACCCGTCAACGACACATGGGGAAACTCAGGT
GCTCCAGCGACCGCGGCGAACGTGGCGGCTTCTGGTCCCCGAAAAGAGGCCATGTGTGTCGGGCTCGGGCCTACG
GATTGA
Gene >Ophio5|512
ATGCAGCTGCCTGAATCTCTGCCTGGCGAGGATTGGGAAAGCTCCGGTGGCCTTGACGCCTCAGGCCGCCAGAAC
GCCCTACGGCTTGCACTGTGGCCGGCTCGGAAAATTAAAACCTTGCACTTCAACCGAAACGCGTTCTTGGTCGCC
TTCTTTCCTCCAGCTTCCCTCACGCATCGCAACGTCTCTGCACAGAACTCCAAGCGCTGAAGCTTCTGAGGCAAA
CGGACATCACTTGACAGCTTCCATCGTTGGTAGGTCCTCTCTCATCTTATTTTCTCGTGCCTTGACATTCGGCTT
GAGAAAAAAATGTGCTGCCTCTTCATGTTCCCTTACCCATCGTCAGAATATCCGCAGTATCGGAAGCAACCCTCT
TGACGTGTCGTGAGATGACGAAGATCGGATGACATAAACTGCCAGTGCTTTTTCTCCGATCCTCTCGCGCGTCTC
GTCTCTTCACATCTTTCCCTCGCCACCTTCTTTCTCGTTACCCATTTCATCCTTTCCTCCTCCTATATTTCACTT
CTGTCCCGCACACTTTCATTTCGACTACTCACGTCGCGTGCAGCATTTTTTCCAGCATGTTCTGGGACAACCCGT
CCACGGCGGCGGACGCCGATGCCACTGAGGCCAACGGTGGGCATGATTCTTCCCGAGGCCCCGACATGGCCGAGA
ACGGTGCTGGGACGGGTGCATGCTACAACTGTGGCGAGATCGGGTACGTTTCATTGTCGACATGGCCAAGGGAAA
CTCGCGTTACTGACTTCTCACTAGACATAGGGCCGCCGACTGCCCAACTCCTCGGGAGGTAACTTGTCGGTACTG
CAATCAGCCCGGCCACATGGTCAAGGATTGCCCTGAGAAGCCAGCCATGATGTGTGAGAATTGTGGCGAAGAAGG
TAGGCCTAGTCGCTGCGGAAGCTGTGCGCTTGAAAAGTTTGAGTCCGCTGACGAGCTGTGCCAATAGGTCACACG
AAGAACAGGTGTGAGAACGCCCGAAAGATCAATCGTGATCATGTTGCCACGCTGTCCCCGGACGATGCCTGGGCC
AAGATCAAGCGCGCCGTCGCTGAGCGGGACATGGACGACGTCAAGGAAGCTGTTCAAGAGTATGTTAAGGCTCTT
GAAGGCGCCGTGACTTACCGAGACCTTCAGGAGGGCTTAATCAATGAGGGTATCAACCTCTTCATCATCGGCATC
GAGCGGCCCCTCGCCCCGGTCTTCACCAACATGGACTTACAGGGGAACATGGGCAAGAAGTTCAGTATCTCCTTC
CGCTTTTCCGAGAAACCCGATCGTCCTCGTGAGGCTGAGGCGTTTCCAAAGAGTCGCGACGAGCTACTGGCTCGC
CTCGAAGACGCCGGCGAGGTCGTCAACAACGGGCGCTCGCTCTGCCACAACTGCGGAGAATTGGGACACGTTGCG
AAATATTGCACCCAGGAAAGGGTGGACAAGCCCGAGGGACCTAAGATTACGTGCACAAATTGCGGAGAGGATGGC
CATCGTCTTCGGGATTGTATGACAGCCCCTATCCGACCTCTTGACAATGAGCCCAAGCTGACGTCTTCGTTTCTA
GGTCCCCAGCCAAGGGTGGACAGATTTGCCTGCCGCAACTGCGGGTACGTCAAGCTCTCTCAGTGTTTGTGTGCT
TATTGCTGATGTTGATTGTAGCAAATCCGGCCACAAGGCGACGGACTGTGAGGAGCCTGCCAACCTTGACAACGT
CGAGTGCCGCAAATGCGGCGAAAGTGAGTCTGCCTGGTAATGTGTCTGCCTCCGATAGATGTGCTAATGCTGCAA
AGCGGGACACTTCTCTCGAGATTGTCCTCAGGCCGGCCCTCGAGGCTGTCGCAACTGCGGCCAGGAAGGCCACAT
CGCAAAAGATTGCGACCAGCCAAGAAACATGGACAATGTCATCTGTCGCAACTGCGAAAAGACAGGCCACGTGAG
CCGAGACTGCCCGGAGCCGAAAGACTGTAAGAGCACTTATCCGGGGAAGCTGGGGCGGCATCAGCTAACATATTT
GCAGGGAGCAAGGTCCAGTGCAGCAATTGCCAGCAGTACGGCCACACCAAGGTCCGCTGCCAGCAGCCGCCGGCG
GAATCCGAGGCTTTCCAGGACGGGGGATTCGACGCCGCCGCAGACAATGCCGGTGAACCCGTCAACGACACATGG
GGAAACTCAGGTGCTCCAGCGACCGCGTCCGACTCGGTGGGATGGTGATTCAGAAGGCTTCGTTGTGGACCAGAC
AGGGCGAACGTGGCGGCTTCTGGTCCCCGAAAAGAGGCCATGTGTGGTAGGCAGCCGGTTTGATTCCCGCTTTTT
ATTTAGAGAAGCTGAGGGTTACCTTACAGTCGGGCTCGGGCCTACGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail