Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5107
Gene name
Locationscaffold_41:48534..52177
Strand+
Gene length (bp)3643
Transcript length (bp)3324
Coding sequence length (bp)3324
Protein length (aa) 1108

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00041 fn3 Fibronectin type III domain 9.3E-09 92 156

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide|Transmembrane domain 0.328 0.3565 0.0796 0.2856 0.156 0.0243 0.7259 0.3618 0.425 0.0797

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1991
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|758
Ophiocordyceps australis map64 (Brazil) OphauB2|4379
Ophiocordyceps camponoti-floridani Ophcf2|02272
Ophiocordyceps camponoti-rufipedis Ophun1|3175
Ophiocordyceps kimflemingae Ophio5|5107 (this protein)
Ophiocordyceps subramaniannii Hirsu2|221

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5107
MLWALPTLTTACFVVCSLYYFFSRHSASPRPALRLCEAAIHASFDAAPLQQLRMALTLGAVVWLLHRSWQTLWKP
VPELVSILGVDIPQAPDVCLAGIGADSATLSWSRPASNRPVQKYLIQVNGVHVGDSPGNETAITVTGLRPNHFYN
LRVVAVGPNSFRAGSPLIRLRTFGKDGRPQLGDSRLPTSFVDPDNPRCESADEGDKHGRSVSSLPMVEAAPVLES
SAILPRDSGVLPSQRRNTVNRRHSPSVAGPDQPPARPSEPEMSLAELNDKFEGIRKEIDDTLALYAKDEAESQQQ
EAELKRDRDRKREILKEKEDHTAQLRINMRVTMELMHRAEKDRAKQEQQLKDKETKKGRIRDSIAKFEMDTERMK
RERKSFEAQKKELARERDRDICKLDNENTKLQEDCNQLEAELRDKGKQLQDFKAAREKQSGADEEMWREEDLKLR
REWELHRRELHSRLAAETKEGHLLSPQIRDLTEQLKVQQVTGLAFYGQPGSSVADYEPSPAAQPKRTAHNGNPLL
KASLPSPDRVPPAEPNLQAAVGFSSASFMPRLFMEPTVDGTNELAADIEFKASGETLSPSAQTLLPSNIFEESEE
ADAMGSKGSLMPEPKPARAAVEEGPQSPASSNLSFNVFPSPHGSAHNLPFPQYTENGEGKSLNAASSTTETPTAG
HKIASFLSTLQRGRAAKCSDAGGPPIGSLKPAQSQSFPSAADEDAMGNRRRINIGSWVVRDSDASDRARPPSAAP
IGTSRPLSALRPNPHKGSPVVAVSDREEELSRPASIASTDLPRPSTDSGSIWGAPGDSLALQKNRLWSRGEGPWP
SRSGSRRPSLQGSTALTTTLASAEDEILGEDELLNPETLPSQVGVIGSRPPGAAKAMSQRLNPAAPTFMAHIFRK
DKDKDKDRSREKAKEEKGKAKEVATSAGDLAPSLDNSPPGSRASRDGHSVHTQVSMSESHESLQLDSTVSNVASD
LQSPSASSLKEQDKSVRKLFRKGSSSKFSLSTRLGKDSSLFKKGPGSAGNSDRNTPVEHRSSIGDADDVGDDGAM
LGRSFDSLASSSSLGPSKSKESRESGRMSSWRFSMSSIKKKGRDTPAKETEQTTDDG*
Coding >Ophio5|5107
ATGTTATGGGCGCTTCCGACCCTGACCACCGCTTGCTTCGTCGTCTGCAGCCTCTACTACTTCTTTAGCCGCCAT
TCAGCCAGCCCCAGGCCGGCCCTGCGCCTGTGTGAGGCCGCCATCCACGCCTCCTTCGATGCCGCGCCTCTTCAG
CAGTTGAGAATGGCCCTGACCCTCGGTGCCGTCGTCTGGCTACTTCATCGTTCGTGGCAGACGCTCTGGAAACCC
GTCCCCGAGCTGGTCAGCATCCTCGGAGTCGACATCCCTCAAGCCCCCGACGTCTGCCTGGCCGGCATTGGCGCC
GACTCGGCGACGCTCAGTTGGTCGCGGCCCGCGTCGAATCGACCTGTGCAAAAGTATCTGATACAGGTCAATGGC
GTTCATGTCGGCGATTCGCCGGGAAACGAGACTGCGATAACCGTCACCGGCTTGCGCCCGAATCACTTCTACAAT
CTGCGCGTCGTCGCCGTCGGCCCCAACAGCTTTCGCGCCGGGAGTCCCTTAATCCGCCTTCGAACCTTTGGCAAA
GATGGCAGACCACAGCTGGGCGACTCGCGCTTGCCCACAAGCTTCGTCGATCCCGATAACCCCCGCTGCGAAAGT
GCCGACGAAGGCGACAAACACGGCCGATCCGTCTCTTCGCTGCCTATGGTGGAGGCCGCCCCAGTTCTCGAAAGC
AGTGCCATCTTGCCCCGGGACTCTGGCGTTCTCCCCAGCCAGCGTCGAAATACCGTCAATCGTCGTCATTCACCT
TCCGTGGCCGGCCCTGATCAGCCCCCGGCCAGGCCGTCGGAGCCGGAAATGTCTCTGGCCGAGCTCAACGACAAG
TTCGAGGGAATTCGAAAGGAAATTGACGACACGCTGGCTCTCTACGCCAAGGATGAGGCCGAGTCTCAGCAGCAG
GAAGCAGAGCTTAAGAGAGACAGGGATCGGAAGAGGGAGATTCTGAAGGAAAAGGAAGACCACACGGCGCAGCTC
AGGATCAACATGCGCGTCACCATGGAGTTGATGCACCGCGCCGAAAAAGACCGTGCCAAACAAGAGCAGCAGCTC
AAGGACAAGGAGACGAAGAAAGGCAGGATCCGCGACAGCATCGCCAAGTTCGAGATGGATACGGAAAGAATGAAA
AGGGAGCGCAAAAGCTTCGAGGCACAAAAGAAGGAGCTGGCGAGGGAGCGGGACCGCGACATCTGCAAGCTCGAC
AACGAAAACACAAAATTGCAGGAAGACTGCAACCAGCTCGAAGCGGAGCTCAGGGACAAGGGCAAGCAGCTTCAG
GATTTCAAGGCTGCCAGGGAGAAGCAGTCGGGAGCCGATGAAGAGATGTGGCGGGAGGAGGACTTAAAGCTTAGA
AGAGAATGGGAGCTTCACAGGAGAGAGCTCCACAGTCGCCTTGCTGCCGAGACCAAAGAGGGGCACCTCCTGAGC
CCGCAGATTCGAGACCTGACGGAGCAGCTGAAAGTTCAGCAGGTGACCGGTCTCGCCTTTTACGGCCAGCCTGGC
TCTTCGGTCGCCGACTATGAGCCGTCGCCGGCAGCCCAGCCCAAGCGCACGGCTCACAACGGCAATCCGCTGCTC
AAGGCCAGCCTGCCTTCGCCCGACCGGGTTCCTCCGGCTGAGCCCAATCTGCAGGCGGCCGTGGGCTTCAGCAGC
GCAAGCTTCATGCCGCGCCTGTTCATGGAGCCGACGGTGGATGGCACCAACGAGCTGGCGGCGGACATCGAGTTT
AAGGCATCTGGTGAGACGCTGAGCCCGTCGGCGCAGACTCTCCTGCCCTCCAACATCTTCGAGGAGAGCGAAGAA
GCGGACGCCATGGGATCCAAGGGCTCCCTCATGCCGGAGCCCAAGCCGGCCAGAGCCGCGGTGGAGGAGGGTCCC
CAGTCCCCGGCCTCTTCCAACCTATCCTTCAACGTGTTTCCGAGCCCGCACGGCTCCGCGCACAACCTCCCCTTT
CCGCAGTATACGGAGAACGGCGAGGGGAAGTCGCTCAACGCAGCCTCCTCAACAACGGAGACGCCGACTGCAGGC
CATAAGATTGCTAGCTTCCTGTCGACGTTGCAACGGGGCCGGGCTGCCAAGTGCTCGGATGCCGGCGGCCCTCCC
ATAGGGAGTCTCAAGCCTGCGCAGAGTCAGTCTTTCCCCTCCGCGGCCGACGAGGACGCCATGGGGAACAGGCGA
AGGATCAACATCGGCTCATGGGTGGTTCGAGACTCGGACGCTTCAGACAGGGCCAGGCCTCCCTCAGCAGCGCCC
ATAGGGACGTCGCGGCCGCTCTCGGCACTGCGCCCCAACCCGCACAAGGGCTCACCTGTCGTGGCCGTATCCGAC
CGAGAAGAGGAGCTTTCCCGGCCGGCGTCGATTGCTTCGACGGATCTGCCGCGTCCTTCGACCGACAGCGGGTCT
ATCTGGGGCGCGCCTGGAGACTCGTTGGCCTTGCAGAAGAACCGGCTCTGGTCCAGAGGAGAAGGGCCGTGGCCT
TCTCGAAGCGGTTCCAGAAGGCCGTCGCTTCAGGGCTCCACGGCCCTGACAACCACGCTCGCTTCTGCCGAGGAC
GAGATACTGGGCGAAGACGAGTTGCTGAACCCGGAGACGCTACCGAGCCAGGTTGGTGTCATCGGATCCCGTCCG
CCGGGCGCCGCCAAGGCCATGAGCCAACGACTCAACCCAGCAGCTCCGACCTTCATGGCCCACATCTTTAGAAAG
GACAAGGACAAGGACAAGGATCGGAGCAGGGAGAAAGCCAAGGAGGAAAAGGGCAAGGCAAAGGAGGTGGCGACC
TCAGCTGGCGACTTGGCGCCCAGCCTTGACAACTCGCCGCCGGGGTCCCGAGCTTCACGCGACGGGCACTCTGTC
CACACGCAGGTCTCCATGTCCGAATCTCACGAATCGTTGCAGCTCGACTCGACAGTCTCGAACGTGGCCTCGGAT
TTGCAATCGCCCTCGGCATCGAGCCTGAAGGAACAGGATAAGTCTGTAAGGAAGCTCTTTCGTAAGGGAAGTTCG
AGCAAGTTCAGCCTGTCAACGAGGCTGGGAAAGGACTCGAGCCTGTTCAAGAAGGGGCCGGGCAGCGCCGGCAAC
TCGGACAGGAACACGCCCGTCGAACACCGATCCAGCATCGGCGACGCGGACGACGTCGGAGACGATGGCGCCATG
CTGGGACGAAGCTTCGATAGCTTGGCGAGCAGCTCGTCTCTCGGTCCGTCCAAGTCTAAGGAAAGCCGTGAATCA
GGTAGGATGAGCAGCTGGCGCTTCTCCATGTCGTCAATTAAGAAGAAGGGCAGAGACACGCCGGCCAAGGAGACG
GAACAGACGACGGACGACGGGTAA
Transcript >Ophio5|5107
ATGTTATGGGCGCTTCCGACCCTGACCACCGCTTGCTTCGTCGTCTGCAGCCTCTACTACTTCTTTAGCCGCCAT
TCAGCCAGCCCCAGGCCGGCCCTGCGCCTGTGTGAGGCCGCCATCCACGCCTCCTTCGATGCCGCGCCTCTTCAG
CAGTTGAGAATGGCCCTGACCCTCGGTGCCGTCGTCTGGCTACTTCATCGTTCGTGGCAGACGCTCTGGAAACCC
GTCCCCGAGCTGGTCAGCATCCTCGGAGTCGACATCCCTCAAGCCCCCGACGTCTGCCTGGCCGGCATTGGCGCC
GACTCGGCGACGCTCAGTTGGTCGCGGCCCGCGTCGAATCGACCTGTGCAAAAGTATCTGATACAGGTCAATGGC
GTTCATGTCGGCGATTCGCCGGGAAACGAGACTGCGATAACCGTCACCGGCTTGCGCCCGAATCACTTCTACAAT
CTGCGCGTCGTCGCCGTCGGCCCCAACAGCTTTCGCGCCGGGAGTCCCTTAATCCGCCTTCGAACCTTTGGCAAA
GATGGCAGACCACAGCTGGGCGACTCGCGCTTGCCCACAAGCTTCGTCGATCCCGATAACCCCCGCTGCGAAAGT
GCCGACGAAGGCGACAAACACGGCCGATCCGTCTCTTCGCTGCCTATGGTGGAGGCCGCCCCAGTTCTCGAAAGC
AGTGCCATCTTGCCCCGGGACTCTGGCGTTCTCCCCAGCCAGCGTCGAAATACCGTCAATCGTCGTCATTCACCT
TCCGTGGCCGGCCCTGATCAGCCCCCGGCCAGGCCGTCGGAGCCGGAAATGTCTCTGGCCGAGCTCAACGACAAG
TTCGAGGGAATTCGAAAGGAAATTGACGACACGCTGGCTCTCTACGCCAAGGATGAGGCCGAGTCTCAGCAGCAG
GAAGCAGAGCTTAAGAGAGACAGGGATCGGAAGAGGGAGATTCTGAAGGAAAAGGAAGACCACACGGCGCAGCTC
AGGATCAACATGCGCGTCACCATGGAGTTGATGCACCGCGCCGAAAAAGACCGTGCCAAACAAGAGCAGCAGCTC
AAGGACAAGGAGACGAAGAAAGGCAGGATCCGCGACAGCATCGCCAAGTTCGAGATGGATACGGAAAGAATGAAA
AGGGAGCGCAAAAGCTTCGAGGCACAAAAGAAGGAGCTGGCGAGGGAGCGGGACCGCGACATCTGCAAGCTCGAC
AACGAAAACACAAAATTGCAGGAAGACTGCAACCAGCTCGAAGCGGAGCTCAGGGACAAGGGCAAGCAGCTTCAG
GATTTCAAGGCTGCCAGGGAGAAGCAGTCGGGAGCCGATGAAGAGATGTGGCGGGAGGAGGACTTAAAGCTTAGA
AGAGAATGGGAGCTTCACAGGAGAGAGCTCCACAGTCGCCTTGCTGCCGAGACCAAAGAGGGGCACCTCCTGAGC
CCGCAGATTCGAGACCTGACGGAGCAGCTGAAAGTTCAGCAGGTGACCGGTCTCGCCTTTTACGGCCAGCCTGGC
TCTTCGGTCGCCGACTATGAGCCGTCGCCGGCAGCCCAGCCCAAGCGCACGGCTCACAACGGCAATCCGCTGCTC
AAGGCCAGCCTGCCTTCGCCCGACCGGGTTCCTCCGGCTGAGCCCAATCTGCAGGCGGCCGTGGGCTTCAGCAGC
GCAAGCTTCATGCCGCGCCTGTTCATGGAGCCGACGGTGGATGGCACCAACGAGCTGGCGGCGGACATCGAGTTT
AAGGCATCTGGTGAGACGCTGAGCCCGTCGGCGCAGACTCTCCTGCCCTCCAACATCTTCGAGGAGAGCGAAGAA
GCGGACGCCATGGGATCCAAGGGCTCCCTCATGCCGGAGCCCAAGCCGGCCAGAGCCGCGGTGGAGGAGGGTCCC
CAGTCCCCGGCCTCTTCCAACCTATCCTTCAACGTGTTTCCGAGCCCGCACGGCTCCGCGCACAACCTCCCCTTT
CCGCAGTATACGGAGAACGGCGAGGGGAAGTCGCTCAACGCAGCCTCCTCAACAACGGAGACGCCGACTGCAGGC
CATAAGATTGCTAGCTTCCTGTCGACGTTGCAACGGGGCCGGGCTGCCAAGTGCTCGGATGCCGGCGGCCCTCCC
ATAGGGAGTCTCAAGCCTGCGCAGAGTCAGTCTTTCCCCTCCGCGGCCGACGAGGACGCCATGGGGAACAGGCGA
AGGATCAACATCGGCTCATGGGTGGTTCGAGACTCGGACGCTTCAGACAGGGCCAGGCCTCCCTCAGCAGCGCCC
ATAGGGACGTCGCGGCCGCTCTCGGCACTGCGCCCCAACCCGCACAAGGGCTCACCTGTCGTGGCCGTATCCGAC
CGAGAAGAGGAGCTTTCCCGGCCGGCGTCGATTGCTTCGACGGATCTGCCGCGTCCTTCGACCGACAGCGGGTCT
ATCTGGGGCGCGCCTGGAGACTCGTTGGCCTTGCAGAAGAACCGGCTCTGGTCCAGAGGAGAAGGGCCGTGGCCT
TCTCGAAGCGGTTCCAGAAGGCCGTCGCTTCAGGGCTCCACGGCCCTGACAACCACGCTCGCTTCTGCCGAGGAC
GAGATACTGGGCGAAGACGAGTTGCTGAACCCGGAGACGCTACCGAGCCAGGTTGGTGTCATCGGATCCCGTCCG
CCGGGCGCCGCCAAGGCCATGAGCCAACGACTCAACCCAGCAGCTCCGACCTTCATGGCCCACATCTTTAGAAAG
GACAAGGACAAGGACAAGGATCGGAGCAGGGAGAAAGCCAAGGAGGAAAAGGGCAAGGCAAAGGAGGTGGCGACC
TCAGCTGGCGACTTGGCGCCCAGCCTTGACAACTCGCCGCCGGGGTCCCGAGCTTCACGCGACGGGCACTCTGTC
CACACGCAGGTCTCCATGTCCGAATCTCACGAATCGTTGCAGCTCGACTCGACAGTCTCGAACGTGGCCTCGGAT
TTGCAATCGCCCTCGGCATCGAGCCTGAAGGAACAGGATAAGTCTGTAAGGAAGCTCTTTCGTAAGGGAAGTTCG
AGCAAGTTCAGCCTGTCAACGAGGCTGGGAAAGGACTCGAGCCTGTTCAAGAAGGGGCCGGGCAGCGCCGGCAAC
TCGGACAGGAACACGCCCGTCGAACACCGATCCAGCATCGGCGACGCGGACGACGTCGGAGACGATGGCGCCATG
CTGGGACGAAGCTTCGATAGCTTGGCGAGCAGCTCGTCTCTCGGTCCGTCCAAGTCTAAGGAAAGCCGTGAATCA
GGTAGGATGAGCAGCTGGCGCTTCTCCATGTCGTCAATTAAGAAGAAGGGCAGAGACACGCCGGCCAAGGAGACG
GAACAGACGACGGACGACGGGTAA
Gene >Ophio5|5107
ATGTTATGGGCGCTTCCGACCCTGACCACCGCTTGCTTCGTCGTCTGCAGCCTCTACTACTTCTTTAGCCGCCAT
TCAGCCAGCCCCAGGTCCGTCCACGCCCACGTCGGCGTTATCGGCCTCGCCCTTCTCATCGACTGCCGCAGGCCG
GCCCTGCGCCTGTGTGAGGCCGCCATCCACGCCTCCTTCGATGCCGCGCCTCTTCAGCAGTTGAGAATGGCCCTG
ACCCTCGGTGCCGTCGTCTGGTGAGTGGCCCTGCCCTACCCTCCTGTCTCGTCTCATCCGCCGTCATGATTGTTT
TTTTTCACCTTCTTTTTGTTGAGGCGCATGCCCAAGGGAGAAGACGCCGTTCTGTGAATTTTTTTTTTTTTCCCT
CTTTCCGACGAAGAACTGTCTTCTCTGCTCCTAGCCCAGGCAAGCTTACTCATGACAATTGGTCCAAAGGCTACT
TCATCGTTCGTGGCAGACGCTCTGGAAACCCGTCCCCGAGCTGGTCAGCATCCTCGGAGTCGACATCCCTCAAGC
CCCCGACGTCTGCCTGGCCGGCATTGGCGCCGACTCGGCGACGCTCAGTTGGTCGCGGCCCGCGTCGAATCGACC
TGTGCAAAAGTATCTGATACAGGTCAATGGCGTTCATGGTCAGTCCCCCACCCAACGGAAAACGTCCGACCTTGT
CGGCCACTAACTCGCCAGTTGCACAGTCGGCGATTCGCCGGGAAACGAGACTGCGATAACCGTCACCGGCTTGCG
CCCGAATCACTTCTACAATCTGCGCGTCGTCGCCGTCGGCCCCAACAGCTTTCGCGCCGGGAGTCCCTTAATCCG
CCTTCGAACCTTTGGCAAAGATGGCAGACCACAGCTGGGCGACTCGCGCTTGCCCACAAGCTTCGTCGATCCCGA
TAACCCCCGCTGCGAAAGTGCCGACGAAGGCGACAAACACGGCCGATCCGTCTCTTCGCTGCCTATGGTGGAGGC
CGCCCCAGTTCTCGAAAGCAGTGCCATCTTGCCCCGGGACTCTGGCGTTCTCCCCAGCCAGCGTCGAAATACCGT
CAATCGTCGTCATTCACCTTCCGTGGCCGGCCCTGATCAGCCCCCGGCCAGGCCGTCGGAGCCGGAAATGTCTCT
GGCCGAGCTCAACGACAAGTTCGAGGGAATTCGAAAGGAAATTGACGACACGCTGGCTCTCTACGCCAAGGATGA
GGCCGAGTCTCAGCAGCAGGAAGCAGAGCTTAAGAGAGACAGGGATCGGAAGAGGGAGATTCTGAAGGAAAAGGA
AGACCACACGGCGCAGCTCAGGATCAACATGCGCGTCACCATGGAGTTGATGCACCGCGCCGAAAAAGACCGTGC
CAAACAAGAGCAGCAGCTCAAGGACAAGGAGACGAAGAAAGGCAGGATCCGCGACAGCATCGCCAAGTTCGAGAT
GGATACGGAAAGAATGAAAAGGGAGCGCAAAAGCTTCGAGGCACAAAAGAAGGAGCTGGCGAGGGAGCGGGACCG
CGACATCTGCAAGCTCGACAACGAAAACACAAAATTGCAGGAAGACTGCAACCAGCTCGAAGCGGAGCTCAGGGA
CAAGGGCAAGCAGCTTCAGGATTTCAAGGCTGCCAGGGAGAAGCAGTCGGGAGCCGATGAAGAGATGTGGCGGGA
GGAGGACTTAAAGCTTAGAAGAGAATGGGAGCTTCACAGGAGAGAGCTCCACAGTCGCCTTGCTGCCGAGACCAA
AGAGGGGCACCTCCTGAGCCCGCAGATTCGAGACCTGACGGAGCAGCTGAAAGTTCAGCAGGTGACCGGTCTCGC
CTTTTACGGCCAGCCTGGCTCTTCGGTCGCCGACTATGAGCCGTCGCCGGCAGCCCAGCCCAAGCGCACGGCTCA
CAACGGCAATCCGCTGCTCAAGGCCAGCCTGCCTTCGCCCGACCGGGTTCCTCCGGCTGAGCCCAATCTGCAGGC
GGCCGTGGGCTTCAGCAGCGCAAGCTTCATGCCGCGCCTGTTCATGGAGCCGACGGTGGATGGCACCAACGAGCT
GGCGGCGGACATCGAGTTTAAGGCATCTGGTGAGACGCTGAGCCCGTCGGCGCAGACTCTCCTGCCCTCCAACAT
CTTCGAGGAGAGCGAAGAAGCGGACGCCATGGGATCCAAGGGCTCCCTCATGCCGGAGCCCAAGCCGGCCAGAGC
CGCGGTGGAGGAGGGTCCCCAGTCCCCGGCCTCTTCCAACCTATCCTTCAACGTGTTTCCGAGCCCGCACGGCTC
CGCGCACAACCTCCCCTTTCCGCAGTATACGGAGAACGGCGAGGGGAAGTCGCTCAACGCAGCCTCCTCAACAAC
GGAGACGCCGACTGCAGGCCATAAGATTGCTAGCTTCCTGTCGACGTTGCAACGGGGCCGGGCTGCCAAGTGCTC
GGATGCCGGCGGCCCTCCCATAGGGAGTCTCAAGCCTGCGCAGAGTCAGTCTTTCCCCTCCGCGGCCGACGAGGA
CGCCATGGGGAACAGGCGAAGGATCAACATCGGCTCATGGGTGGTTCGAGACTCGGACGCTTCAGACAGGGCCAG
GCCTCCCTCAGCAGCGCCCATAGGGACGTCGCGGCCGCTCTCGGCACTGCGCCCCAACCCGCACAAGGGCTCACC
TGTCGTGGCCGTATCCGACCGAGAAGAGGAGCTTTCCCGGCCGGCGTCGATTGCTTCGACGGATCTGCCGCGTCC
TTCGACCGACAGCGGGTCTATCTGGGGCGCGCCTGGAGACTCGTTGGCCTTGCAGAAGAACCGGCTCTGGTCCAG
AGGAGAAGGGCCGTGGCCTTCTCGAAGCGGTTCCAGAAGGCCGTCGCTTCAGGGCTCCACGGCCCTGACAACCAC
GCTCGCTTCTGCCGAGGACGAGATACTGGGCGAAGACGAGTTGCTGAACCCGGAGACGCTACCGAGCCAGGTTGG
TGTCATCGGATCCCGTCCGCCGGGCGCCGCCAAGGCCATGAGCCAACGACTCAACCCAGCAGCTCCGACCTTCAT
GGCCCACATCTTTAGAAAGGACAAGGACAAGGACAAGGATCGGAGCAGGGAGAAAGCCAAGGAGGAAAAGGGCAA
GGCAAAGGAGGTGGCGACCTCAGCTGGCGACTTGGCGCCCAGCCTTGACAACTCGCCGCCGGGGTCCCGAGCTTC
ACGCGACGGGCACTCTGTCCACACGCAGGTCTCCATGTCCGAATCTCACGAATCGTTGCAGCTCGACTCGACAGT
CTCGAACGTGGCCTCGGATTTGCAATCGCCCTCGGCATCGAGCCTGAAGGAACAGGATAAGTCTGTAAGGAAGCT
CTTTCGTAAGGGAAGTTCGAGCAAGTTCAGCCTGTCAACGAGGCTGGGAAAGGACTCGAGCCTGTTCAAGAAGGG
GCCGGGCAGCGCCGGCAACTCGGACAGGAACACGCCCGTCGAACACCGATCCAGCATCGGCGACGCGGACGACGT
CGGAGACGATGGCGCCATGCTGGGACGAAGCTTCGATAGCTTGGCGAGCAGCTCGTCTCTCGGTCCGTCCAAGTC
TAAGGAAAGCCGTGAATCAGGTAGGATGAGCAGCTGGCGCTTCTCCATGTCGTCAATTAAGAAGAAGGGCAGAGA
CACGCCGGCCAAGGAGACGGAACAGACGACGGACGACGGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail