Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5104
Gene name
Locationscaffold_41:39574..40402
Strand-
Gene length (bp)828
Transcript length (bp)828
Coding sequence length (bp)825
Protein length (aa) 275

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02291 TFIID-31kDa Transcription initiation factor IID, 31kD subunit 1.1E-40 64 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05027|TAF9_YEAST Transcription initiation factor TFIID subunit 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF9 PE=1 SV=1 59 211 7.0E-26
sp|Q09869|TAF9_SCHPO Transcription initiation factor TFIID subunit 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf9 PE=1 SV=1 67 233 3.0E-20
sp|Q5R7P7|TAF9B_PONAB Transcription initiation factor TFIID subunit 9B OS=Pongo abelii GN=TAF9B PE=2 SV=1 67 221 2.0E-12
sp|Q9HBM6|TAF9B_HUMAN Transcription initiation factor TFIID subunit 9B OS=Homo sapiens GN=TAF9B PE=1 SV=1 67 221 2.0E-12
sp|Q6NZA9|TAF9B_MOUSE Transcription initiation factor TFIID subunit 9B OS=Mus musculus GN=Taf9b PE=1 SV=2 67 221 6.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05027|TAF9_YEAST Transcription initiation factor TFIID subunit 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF9 PE=1 SV=1 59 211 7.0E-26
sp|Q09869|TAF9_SCHPO Transcription initiation factor TFIID subunit 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf9 PE=1 SV=1 67 233 3.0E-20
sp|Q5R7P7|TAF9B_PONAB Transcription initiation factor TFIID subunit 9B OS=Pongo abelii GN=TAF9B PE=2 SV=1 67 221 2.0E-12
sp|Q9HBM6|TAF9B_HUMAN Transcription initiation factor TFIID subunit 9B OS=Homo sapiens GN=TAF9B PE=1 SV=1 67 221 2.0E-12
sp|Q6NZA9|TAF9B_MOUSE Transcription initiation factor TFIID subunit 9B OS=Mus musculus GN=Taf9b PE=1 SV=2 67 221 6.0E-12
sp|Q62880|TAF9B_RAT Transcription initiation factor TFIID subunit 9B OS=Rattus norvegicus GN=Taf9b PE=2 SV=2 67 221 7.0E-12
sp|Q16594|TAF9_HUMAN Transcription initiation factor TFIID subunit 9 OS=Homo sapiens GN=TAF9 PE=1 SV=1 67 221 1.0E-11
sp|Q8VI33|TAF9_MOUSE Transcription initiation factor TFIID subunit 9 OS=Mus musculus GN=Taf9 PE=1 SV=1 67 214 2.0E-11
sp|Q5BKE0|TAF9_RAT Transcription initiation factor TFIID subunit 9 OS=Rattus norvegicus GN=Taf9 PE=2 SV=1 67 214 3.0E-11
sp|Q17QQ4|TAF9_BOVIN Transcription initiation factor TFIID subunit 9 OS=Bos taurus GN=TAF9 PE=2 SV=1 67 221 5.0E-11
sp|Q27272|TAF9_DROME Transcription initiation factor TFIID subunit 9 OS=Drosophila melanogaster GN=e(y)1 PE=1 SV=1 67 210 3.0E-08
sp|Q9SYH2|TAF9_ARATH Transcription initiation factor TFIID subunit 9 OS=Arabidopsis thaliana GN=TAF9 PE=1 SV=1 67 209 4.0E-08
sp|Q8SSI9|TAF9_ENCCU Transcription initiation factor TFIID subunit 9 OS=Encephalitozoon cuniculi (strain GB-M1) GN=TAF9 PE=1 SV=1 67 123 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006352 DNA-templated transcription, initiation Yes
GO:0043170 macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0009987 cellular process No
GO:0032774 RNA biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0016070 RNA metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0009058 biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5104
MASTQPQTNGAGPSAAPPSTNSSQTLPNTLPPTSSVTASQPQPQSQPQPPPAPSTAPAPPTASDPRPRDARLIEL
LLTSQGVTSYEQRVPLLLLDFAYRHASAVLSDALHLAGDPHVTQAGGKPSASSGAIATAPGEAPITANAIKLAIS
ARLSYQFRGGSAGGGIDKDHMQELARERNKVALPRIVPNEWGVRLPSERFVLSGASWGLKDMWEGDGPDGGDDDD
DDDDDDQLGGDAMEGVQGPDPEDIGGDGVEGGTVEDVFGEDVDEVMEENG
Coding >Ophio5|5104
ATGGCCTCGACCCAGCCGCAGACCAACGGCGCCGGCCCCAGCGCTGCTCCCCCCTCGACAAACTCATCCCAGACG
CTTCCCAACACTCTGCCGCCCACCTCGAGCGTCACCGCTTCGCAGCCGCAGCCGCAATCGCAACCGCAACCTCCT
CCCGCGCCGAGCACTGCTCCCGCGCCGCCGACGGCCTCCGACCCCAGACCTCGCGACGCCCGCCTGATCGAGCTG
CTACTCACGTCGCAGGGCGTCACCTCGTACGAACAGCGCGTTCCGCTCCTTCTCCTCGACTTCGCCTATCGTCAC
GCCTCCGCCGTCCTCAGCGACGCTCTGCATCTGGCCGGCGATCCGCACGTTACTCAAGCTGGCGGTAAGCCGTCC
GCCTCGTCCGGCGCCATCGCCACCGCGCCCGGCGAGGCTCCCATCACGGCGAATGCCATCAAGTTGGCCATTAGC
GCCAGACTGTCCTATCAGTTTCGCGGTGGGAGTGCCGGCGGCGGCATCGACAAGGATCATATGCAGGAGCTGGCC
CGAGAGCGCAATAAGGTCGCCCTGCCGAGAATCGTGCCCAACGAGTGGGGCGTCCGTCTGCCCAGCGAGCGCTTC
GTTCTCAGTGGCGCAAGCTGGGGTCTCAAGGACATGTGGGAGGGCGACGGGCCTGACGGCGGCGACGACGACGAC
GACGACGACGACGACGACCAACTGGGCGGGGATGCCATGGAGGGCGTCCAAGGACCAGATCCCGAAGATATCGGC
GGCGATGGCGTTGAGGGAGGCACGGTAGAGGACGTGTTTGGCGAAGACGTCGACGAGGTGATGGAAGAGAATGGC
Transcript >Ophio5|5104
ATGGCCTCGACCCAGCCGCAGACCAACGGCGCCGGCCCCAGCGCTGCTCCCCCCTCGACAAACTCATCCCAGACG
CTTCCCAACACTCTGCCGCCCACCTCGAGCGTCACCGCTTCGCAGCCGCAGCCGCAATCGCAACCGCAACCTCCT
CCCGCGCCGAGCACTGCTCCCGCGCCGCCGACGGCCTCCGACCCCAGACCTCGCGACGCCCGCCTGATCGAGCTG
CTACTCACGTCGCAGGGCGTCACCTCGTACGAACAGCGCGTTCCGCTCCTTCTCCTCGACTTCGCCTATCGTCAC
GCCTCCGCCGTCCTCAGCGACGCTCTGCATCTGGCCGGCGATCCGCACGTTACTCAAGCTGGCGGTAAGCCGTCC
GCCTCGTCCGGCGCCATCGCCACCGCGCCCGGCGAGGCTCCCATCACGGCGAATGCCATCAAGTTGGCCATTAGC
GCCAGACTGTCCTATCAGTTTCGCGGTGGGAGTGCCGGCGGCGGCATCGACAAGGATCATATGCAGGAGCTGGCC
CGAGAGCGCAATAAGGTCGCCCTGCCGAGAATCGTGCCCAACGAGTGGGGCGTCCGTCTGCCCAGCGAGCGCTTC
GTTCTCAGTGGCGCAAGCTGGGGTCTCAAGGACATGTGGGAGGGCGACGGGCCTGACGGCGGCGACGACGACGAC
GACGACGACGACGACGACCAACTGGGCGGGGATGCCATGGAGGGCGTCCAAGGACCAGATCCCGAAGATATCGGC
GGCGATGGCGTTGAGGGAGGCACGGTAGAGGACGTGTTTGGCGAAGACGTCGACGAGGTGATGGAAGAGAATGGC
TAG
Gene >Ophio5|5104
ATGGCCTCGACCCAGCCGCAGACCAACGGCGCCGGCCCCAGCGCTGCTCCCCCCTCGACAAACTCATCCCAGACG
CTTCCCAACACTCTGCCGCCCACCTCGAGCGTCACCGCTTCGCAGCCGCAGCCGCAATCGCAACCGCAACCTCCT
CCCGCGCCGAGCACTGCTCCCGCGCCGCCGACGGCCTCCGACCCCAGACCTCGCGACGCCCGCCTGATCGAGCTG
CTACTCACGTCGCAGGGCGTCACCTCGTACGAACAGCGCGTTCCGCTCCTTCTCCTCGACTTCGCCTATCGTCAC
GCCTCCGCCGTCCTCAGCGACGCTCTGCATCTGGCCGGCGATCCGCACGTTACTCAAGCTGGCGGTAAGCCGTCC
GCCTCGTCCGGCGCCATCGCCACCGCGCCCGGCGAGGCTCCCATCACGGCGAATGCCATCAAGTTGGCCATTAGC
GCCAGACTGTCCTATCAGTTTCGCGGTGGGAGTGCCGGCGGCGGCATCGACAAGGATCATATGCAGGAGCTGGCC
CGAGAGCGCAATAAGGTCGCCCTGCCGAGAATCGTGCCCAACGAGTGGGGCGTCCGTCTGCCCAGCGAGCGCTTC
GTTCTCAGTGGCGCAAGCTGGGGTCTCAAGGACATGTGGGAGGGCGACGGGCCTGACGGCGGCGACGACGACGAC
GACGACGACGACGACGACCAACTGGGCGGGGATGCCATGGAGGGCGTCCAAGGACCAGATCCCGAAGATATCGGC
GGCGATGGCGTTGAGGGAGGCACGGTAGAGGACGTGTTTGGCGAAGACGTCGACGAGGTGATGGAAGAGAATGGC
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail