Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5100
Gene name
Locationscaffold_41:32350..33201
Strand+
Gene length (bp)851
Transcript length (bp)714
Coding sequence length (bp)711
Protein length (aa) 237

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 2.6E-14 96 186
PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain 9.7E-08 92 196

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USH6|YJQ4_SCHPO Uncharacterized N-acetyltransferase C825.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC825.04c PE=1 SV=1 64 211 2.0E-27
sp|Q568K5|NAA40_DANRE N-alpha-acetyltransferase 40 OS=Danio rerio GN=naa40 PE=2 SV=1 42 215 4.0E-13
sp|Q6NUH2|NAA40_XENLA N-alpha-acetyltransferase 40 OS=Xenopus laevis GN=naa40 PE=2 SV=1 79 215 1.0E-12
sp|Q8VE10|NAA40_MOUSE N-alpha-acetyltransferase 40 OS=Mus musculus GN=Naa40 PE=1 SV=1 79 215 4.0E-12
sp|Q86UY6|NAA40_HUMAN N-alpha-acetyltransferase 40 OS=Homo sapiens GN=NAA40 PE=1 SV=1 79 215 4.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USH6|YJQ4_SCHPO Uncharacterized N-acetyltransferase C825.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC825.04c PE=1 SV=1 64 211 2.0E-27
sp|Q568K5|NAA40_DANRE N-alpha-acetyltransferase 40 OS=Danio rerio GN=naa40 PE=2 SV=1 42 215 4.0E-13
sp|Q6NUH2|NAA40_XENLA N-alpha-acetyltransferase 40 OS=Xenopus laevis GN=naa40 PE=2 SV=1 79 215 1.0E-12
sp|Q8VE10|NAA40_MOUSE N-alpha-acetyltransferase 40 OS=Mus musculus GN=Naa40 PE=1 SV=1 79 215 4.0E-12
sp|Q86UY6|NAA40_HUMAN N-alpha-acetyltransferase 40 OS=Homo sapiens GN=NAA40 PE=1 SV=1 79 215 4.0E-12
sp|Q04751|NAT4_YEAST Histone-specific N-acetyltransferase NAT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAT4 PE=1 SV=1 64 206 8.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0008080 N-acetyltransferase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0016746 acyltransferase activity No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0016410 N-acyltransferase activity No
GO:0003674 molecular_function No
GO:0016407 acetyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5100
MMALTSTQEATKALETAKLATDEEFLQRYVQPRPDSWPSWTHPRSGAQYRLRLVGTAALRATELEACLRLVCETS
GDAYRASATGWRPVAKRREMTTSGMRYLLVEDEQGRLMGFVSLLPTWEGGRPVVYCYEIHLDAALRGTGLGTLLM
GYVAAAAERIERVEKVMLTCFTSNKRGLDFYTRLGYAPDASSPQERTLRGGRVVVPDYVILSRPTANNLVRTRLL
KDDDDDDDDDGP
Coding >Ophio5|5100
ATGATGGCCTTGACTTCAACCCAAGAGGCAACAAAAGCCCTTGAGACCGCCAAGTTGGCGACTGACGAGGAATTC
CTACAGCGATACGTACAGCCAAGGCCAGACAGTTGGCCCTCGTGGACGCACCCTCGCTCCGGGGCGCAGTACCGG
CTGCGACTCGTCGGCACGGCTGCGCTCCGGGCGACGGAGCTGGAGGCATGTCTGAGACTGGTGTGCGAGACGAGC
GGCGACGCCTATCGCGCTTCGGCGACGGGATGGCGGCCGGTGGCGAAGAGGAGGGAGATGACGACTTCGGGCATG
CGCTATCTACTGGTAGAGGATGAGCAGGGGAGGCTTATGGGGTTTGTGTCGTTGTTGCCGACGTGGGAGGGGGGC
CGGCCAGTTGTATACTGCTATGAGATTCATCTTGATGCGGCGCTACGAGGCACCGGCCTCGGCACGCTTCTTATG
GGCTACGTGGCAGCGGCAGCGGAGCGCATCGAGCGAGTGGAAAAGGTGATGCTGACGTGCTTCACGAGCAACAAG
CGGGGCCTCGACTTTTACACGCGTCTGGGCTACGCGCCCGACGCCTCGTCGCCGCAAGAGCGTACGCTGAGGGGA
GGCAGGGTCGTCGTGCCGGACTATGTCATCCTGAGCCGGCCGACGGCTAACAACTTGGTGAGGACGAGGTTGTTG
AAAGACGACGACGACGACGACGACGACGACGGTCCG
Transcript >Ophio5|5100
ATGATGGCCTTGACTTCAACCCAAGAGGCAACAAAAGCCCTTGAGACCGCCAAGTTGGCGACTGACGAGGAATTC
CTACAGCGATACGTACAGCCAAGGCCAGACAGTTGGCCCTCGTGGACGCACCCTCGCTCCGGGGCGCAGTACCGG
CTGCGACTCGTCGGCACGGCTGCGCTCCGGGCGACGGAGCTGGAGGCATGTCTGAGACTGGTGTGCGAGACGAGC
GGCGACGCCTATCGCGCTTCGGCGACGGGATGGCGGCCGGTGGCGAAGAGGAGGGAGATGACGACTTCGGGCATG
CGCTATCTACTGGTAGAGGATGAGCAGGGGAGGCTTATGGGGTTTGTGTCGTTGTTGCCGACGTGGGAGGGGGGC
CGGCCAGTTGTATACTGCTATGAGATTCATCTTGATGCGGCGCTACGAGGCACCGGCCTCGGCACGCTTCTTATG
GGCTACGTGGCAGCGGCAGCGGAGCGCATCGAGCGAGTGGAAAAGGTGATGCTGACGTGCTTCACGAGCAACAAG
CGGGGCCTCGACTTTTACACGCGTCTGGGCTACGCGCCCGACGCCTCGTCGCCGCAAGAGCGTACGCTGAGGGGA
GGCAGGGTCGTCGTGCCGGACTATGTCATCCTGAGCCGGCCGACGGCTAACAACTTGGTGAGGACGAGGTTGTTG
AAAGACGACGACGACGACGACGACGACGACGGTCCGTGA
Gene >Ophio5|5100
ATGATGGCCTTGACTTCAACCCAAGAGGCAACAAAAGCCCTTGAGACCGCCAAGTTGGCGACTGACGAGGAATTC
CTACAGCGATACGTACAGCCAAGGTAAGGAGAAGAAAGGAAAAAGAAGCCGTAGGGGCCCGGTGTCTGACCTCAG
GCCCTGGAGAGCACGCCCTTGAACCAAGGCCAGACAGTTGGCCCTCGTGGACGCACCCTCGCTCCGGGGCGCAGT
ACCGGCTGCGACTCGTCGGCACGGCTGCGCTCCGGGCGACGGAGCTGGAGGCATGTCTGAGACTGGTGTGCGAGA
CGAGCGGCGACGCCTATCGCGCTTCGGCGACGGGATGGCGGCCGGTGGCGAAGAGGAGGGAGATGACGACTTCGG
GCATGCGCTATCTACTGGTAGAGGATGAGCAGGGGAGGCTTATGGGGTTTGTGTCGTTGTTGCCGACGTGGGAGG
GGGGCCGGCCAGTTGTATACTGCTATGAGATTCATCTTGATGCGGCGCTACGAGGGTGAGTCTTCTTCTCTCACC
ATGTGTCGACTGAATGATCTCTGACTAAGGCCTTCAGCACCGGCCTCGGCACGCTTCTTATGGGCTACGTGGCAG
CGGCAGCGGAGCGCATCGAGCGAGTGGAAAAGGTGATGCTGACGTGCTTCACGAGCAACAAGCGGGGCCTCGACT
TTTACACGCGTCTGGGCTACGCGCCCGACGCCTCGTCGCCGCAAGAGCGTACGCTGAGGGGAGGCAGGGTCGTCG
TGCCGGACTATGTCATCCTGAGCCGGCCGACGGCTAACAACTTGGTGAGGACGAGGTTGTTGAAAGACGACGACG
ACGACGACGACGACGACGGTCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail