Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5099
Gene name
Locationscaffold_41:31759..32168
Strand-
Gene length (bp)409
Transcript length (bp)285
Coding sequence length (bp)282
Protein length (aa) 94

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05347 Complex1_LYR Complex 1 protein (LYR family) 4.5E-16 29 84
PF13233 Complex1_LYR_2 Complex1_LYR-like 1.3E-05 30 90

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|B5XFA7|LYRM2_SALSA LYR motif-containing protein 2 OS=Salmo salar GN=lyrm2 PE=3 SV=1 15 88 3.0E-08
sp|Q5RIM0|LYRM2_DANRE LYR motif-containing protein 2 OS=Danio rerio GN=lyrm2 PE=3 SV=1 15 91 1.0E-07
sp|Q5PQ90|LYRM2_XENLA LYR motif-containing protein 2 OS=Xenopus laevis GN=lyrm2 PE=3 SV=1 15 91 8.0E-07
sp|B3DLF3|LYRM2_XENTR LYR motif-containing protein 2 OS=Xenopus tropicalis GN=lyrm2 PE=3 SV=1 15 91 2.0E-06
sp|B2GV91|LYRM2_RAT LYR motif-containing protein 2 OS=Rattus norvegicus GN=Lyrm2 PE=3 SV=1 17 91 4.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5099
MRPSARATLRIANRPRPPLSLQHFLQRARVLALYRTMMRATGRIGDARTKAETRKHVRDEFERYRHVEDLSHIRY
LVSTGKTQWESMQRYIDGL
Coding >Ophio5|5099
ATGAGGCCCTCCGCTCGCGCGACCCTGCGCATCGCCAACCGCCCGCGCCCCCCACTGAGCCTCCAGCACTTCCTA
CAAAGAGCCCGGGTCCTGGCTCTGTACCGCACCATGATGCGGGCCACGGGGCGCATTGGCGATGCTCGGACCAAG
GCTGAGACGCGCAAGCATGTGCGCGATGAGTTTGAGCGGTATCGCCACGTTGAGGATCTTTCGCATATACGGTAC
CTCGTGTCGACGGGTAAGACGCAGTGGGAGAGTATGCAGAGGTATATAGATGGCTTG
Transcript >Ophio5|5099
ATGAGGCCCTCCGCTCGCGCGACCCTGCGCATCGCCAACCGCCCGCGCCCCCCACTGAGCCTCCAGCACTTCCTA
CAAAGAGCCCGGGTCCTGGCTCTGTACCGCACCATGATGCGGGCCACGGGGCGCATTGGCGATGCTCGGACCAAG
GCTGAGACGCGCAAGCATGTGCGCGATGAGTTTGAGCGGTATCGCCACGTTGAGGATCTTTCGCATATACGGTAC
CTCGTGTCGACGGGTAAGACGCAGTGGGAGAGTATGCAGAGGTATATAGATGGCTTGTAG
Gene >Ophio5|5099
ATGAGGCCCTCCGCTCGCGCGACCCTGCGCATCGCCAACCGCCCGCGCCCCCCACTGAGCCTCCAGCACGTAAAG
AAACCAGAAACCAGCCTCTTCTACCCAACATTACAGTCTGACAAGCGCAGTTCCTACAAAGAGCCCGGGTCCTGG
CTCTGTACCGCACCATGATGCGGGCCACGGGGCGCATTGGCGATGCTCGGACCAAGGCTGAGACGCGCAAGCATG
TGCGCGATGAGTTTGAGCGGTATCGCCACGTTGAGGATCTTGTCAGTTGCGCGAGTCCCTCCCCTTTGGTCCGAA
AGCGTGTTGACATCGTTCTGCTTTCTTTACCAAGTCGCATATACGGTACCTCGTGTCGACGGGTAAGACGCAGTG
GGAGAGTATGCAGAGGTATATAGATGGCTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail