Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5085
Gene name
Locationscaffold_41:661..3303
Strand-
Gene length (bp)2642
Transcript length (bp)2466
Coding sequence length (bp)2463
Protein length (aa) 821

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01544 CorA CorA-like Mg2+ transporter protein 7.9E-36 493 812

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13779|YF2E_SCHPO Putative metal ion transporter C17A12.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.14 PE=1 SV=4 492 821 7.0E-128
sp|O13657|YBCC_SCHPO Putative metal ion transporter C27B12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi066 PE=1 SV=1 476 816 6.0E-120
sp|P43553|ALR2_YEAST Magnesium transporter ALR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALR2 PE=1 SV=1 487 815 2.0E-102
sp|Q08269|ALR1_YEAST Magnesium transporter ALR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALR1 PE=1 SV=1 267 799 3.0E-97
sp|P35724|MNR2_YEAST Manganese resistance protein MNR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNR2 PE=1 SV=1 553 818 2.0E-92
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13779|YF2E_SCHPO Putative metal ion transporter C17A12.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.14 PE=1 SV=4 492 821 7.0E-128
sp|O13657|YBCC_SCHPO Putative metal ion transporter C27B12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi066 PE=1 SV=1 476 816 6.0E-120
sp|P43553|ALR2_YEAST Magnesium transporter ALR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALR2 PE=1 SV=1 487 815 2.0E-102
sp|Q08269|ALR1_YEAST Magnesium transporter ALR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALR1 PE=1 SV=1 267 799 3.0E-97
sp|P35724|MNR2_YEAST Manganese resistance protein MNR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNR2 PE=1 SV=1 553 818 2.0E-92
sp|P35724|MNR2_YEAST Manganese resistance protein MNR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNR2 PE=1 SV=1 348 545 1.0E-23
sp|Q9WZ31|CORA_THEMA Magnesium transport protein CorA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=corA PE=1 SV=1 507 816 3.0E-17
sp|O31543|YFJQ_BACSU Putative metal ion transporter YfjQ OS=Bacillus subtilis (strain 168) GN=yfjQ PE=3 SV=1 492 781 8.0E-12
sp|O13779|YF2E_SCHPO Putative metal ion transporter C17A12.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.14 PE=1 SV=4 300 386 4.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0030001 metal ion transport Yes
GO:0055085 transmembrane transport Yes
GO:0015075 ion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0008324 cation transmembrane transporter activity No
GO:0006811 ion transport No
GO:0006812 cation transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

Domain # Start End Length
1 795 814 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5085
MFGATNPASSSSTAPAVPAPSSDQQKSRTVRKRKGHRGGKKKRTRRKSFAALTEDSHDEMHHSPADAFYQMPASS
LSGASIDSEALLDHRDQRSMRIRRSSVAASSALHNPYATPATSHLRAMQTSTSDDDTPGRDETAPLLSETARLRA
SPTGYPGYGTSDPRVGRVRSRRDSSRSSRTKLGAVSAMKDSYDVNHPPSVPGSPTFGAADHPEMVFGDVMIRDEL
SLRSGSPRFSLDADADLSTADGPVRDHRPDHGRRLTVSGSGDVCFPVRGMSELGEEDAHSRDPELHQYRARRRRG
QWPDLSTLEEWKRFEKEEHSEERRVKKITEPQLINGRLRPVRKGWYQSDDEAPYRFTYFNEEFQSTIHSPTISEL
VQPGSDFRELFIPDPRVLSDDETDDEGETMSPQVRPYPTRGGDGGSRTPTRLPSYADSRRDAFASPARDVATPVM
PASGRATPLPVRSPEHENKAQSRDRESASTTKPVRYGDRPVWWLDVLCPTEAEMKVIAKAFGIHPLTAEDIMVQE
AREKVELFRHYYFVNYRTFDQDLNGGNDLEPINMYVVVFREGVLSFHFSMTPHPANVRRRIRQLRDYLILSSDWI
SYAIIDDITDVFQPLIQNIEAEVDEIDGEILQLHSSADKRIKDQKNSAGNDDNATAIVDSSDMLRRVGDCRKRVM
SLYRLLGNKADVIKGFAKRCNERWEVAPRSEIGLYLGDIQDHIVTMTSNLGHYEKILARTHANYLAQINIRMNER
QEQTADVLGRLTVLGTIVLPMNIITGLWGMNVWVPGQQHEGDLSWFVWITVGLVGFGLACYLIAKRVYKIV
Coding >Ophio5|5085
ATGTTTGGTGCCACAAACCCCGCATCCTCGTCGTCGACGGCTCCCGCAGTACCCGCACCGTCATCCGACCAGCAG
AAGTCTCGGACGGTGAGGAAGCGGAAGGGCCATCGCGGCGGAAAGAAGAAGCGCACGCGCAGGAAGAGCTTCGCC
GCTCTGACCGAGGATAGCCATGACGAGATGCATCACTCTCCGGCCGACGCTTTCTACCAGATGCCCGCCTCCAGC
CTCAGTGGCGCCAGCATCGACAGTGAGGCGCTTCTGGACCACAGGGACCAGAGGTCAATGCGCATTCGCAGGAGC
TCCGTCGCCGCTTCCAGCGCTCTACACAATCCCTATGCCACGCCTGCTACGAGCCACCTCCGAGCGATGCAGACC
TCGACCAGCGATGACGATACTCCCGGCCGAGACGAGACTGCCCCGTTACTGTCCGAAACCGCCCGTCTCCGAGCC
TCCCCTACCGGCTACCCGGGCTACGGCACCTCGGACCCGAGAGTCGGTCGGGTTCGAAGCCGCAGGGACTCCAGC
CGGTCGTCGAGGACCAAGCTCGGCGCCGTGTCGGCCATGAAAGACTCGTACGATGTCAATCACCCGCCCTCAGTC
CCCGGCTCGCCCACTTTTGGCGCCGCCGATCACCCGGAGATGGTCTTTGGCGATGTCATGATCAGGGACGAGCTG
TCGCTGCGCAGCGGCAGTCCCCGTTTCTCCCTCGACGCCGACGCCGACCTCTCCACCGCCGACGGCCCGGTCCGA
GACCACCGTCCTGACCATGGGCGGAGGCTCACCGTGTCCGGCTCCGGCGACGTGTGCTTCCCCGTCCGCGGAATG
TCCGAGCTCGGTGAGGAAGACGCCCACTCACGAGACCCCGAGCTGCACCAGTACAGAGCACGTCGTCGCCGCGGC
CAGTGGCCCGACCTGTCGACGCTGGAAGAGTGGAAGCGCTTCGAGAAGGAGGAGCACAGCGAGGAGAGGCGGGTC
AAGAAGATCACCGAGCCGCAGCTCATCAATGGCCGGCTTCGCCCGGTTCGCAAGGGCTGGTACCAGAGCGACGAC
GAAGCCCCTTACAGATTCACCTACTTTAACGAGGAATTTCAGAGCACCATACACAGCCCCACCATATCCGAGCTC
GTCCAACCGGGCAGCGACTTTCGGGAGCTCTTCATTCCGGATCCGCGCGTCCTGTCCGACGATGAGACCGACGAC
GAAGGCGAGACCATGTCGCCGCAGGTCAGACCTTACCCCACAAGGGGCGGCGATGGCGGATCCAGGACGCCGACG
CGGTTGCCGTCTTATGCAGATTCTCGCCGCGACGCCTTTGCCTCGCCGGCGCGGGACGTGGCCACACCCGTCATG
CCGGCCTCGGGCCGCGCGACGCCCCTGCCTGTCAGGTCTCCTGAACATGAGAACAAGGCGCAATCTCGCGATCGG
GAATCGGCCTCGACGACGAAGCCGGTTCGGTACGGAGACCGGCCGGTCTGGTGGCTCGACGTCCTCTGCCCGACA
GAGGCGGAGATGAAGGTCATCGCCAAGGCTTTTGGCATCCATCCCCTTACGGCCGAGGACATTATGGTGCAGGAG
GCCCGGGAAAAGGTCGAGCTGTTCCGGCACTACTACTTTGTCAACTATCGCACCTTCGACCAGGACCTCAACGGC
GGCAATGACCTCGAGCCCATCAACATGTACGTCGTCGTCTTCCGTGAGGGCGTGCTCAGCTTCCACTTCTCCATG
ACGCCTCACCCCGCCAACGTGCGGAGGCGAATCCGTCAGCTCAGAGACTACCTGATCCTCTCGTCCGACTGGATC
TCGTACGCCATCATCGACGACATTACCGACGTCTTCCAGCCCCTGATTCAGAACATCGAGGCCGAGGTGGACGAG
ATCGACGGCGAGATTCTTCAGCTGCACTCGTCGGCCGACAAGCGCATCAAAGACCAGAAAAACTCGGCCGGCAAC
GACGACAACGCCACGGCCATTGTCGACTCCAGTGACATGCTGCGCCGGGTCGGGGACTGCAGGAAGAGGGTCATG
AGCCTGTACCGCCTGCTCGGCAACAAGGCGGATGTCATCAAGGGCTTCGCGAAACGCTGCAACGAGCGGTGGGAA
GTTGCGCCGCGGTCCGAGATTGGCCTGTATCTGGGCGACATTCAGGATCATATAGTGACCATGACGTCGAACCTT
GGCCACTACGAGAAGATCCTGGCCCGGACGCACGCCAACTACCTAGCCCAGATCAACATTCGCATGAACGAGCGG
CAGGAACAGACTGCCGACGTTCTCGGCAGGCTCACGGTGCTGGGCACCATCGTGCTGCCCATGAACATCATAACC
GGCCTCTGGGGCATGAACGTCTGGGTCCCGGGCCAGCAGCACGAGGGAGACCTGAGCTGGTTCGTATGGATCACG
GTGGGCCTCGTCGGCTTCGGTCTCGCGTGCTACCTGATCGCCAAGCGGGTGTACAAAATTGTC
Transcript >Ophio5|5085
ATGTTTGGTGCCACAAACCCCGCATCCTCGTCGTCGACGGCTCCCGCAGTACCCGCACCGTCATCCGACCAGCAG
AAGTCTCGGACGGTGAGGAAGCGGAAGGGCCATCGCGGCGGAAAGAAGAAGCGCACGCGCAGGAAGAGCTTCGCC
GCTCTGACCGAGGATAGCCATGACGAGATGCATCACTCTCCGGCCGACGCTTTCTACCAGATGCCCGCCTCCAGC
CTCAGTGGCGCCAGCATCGACAGTGAGGCGCTTCTGGACCACAGGGACCAGAGGTCAATGCGCATTCGCAGGAGC
TCCGTCGCCGCTTCCAGCGCTCTACACAATCCCTATGCCACGCCTGCTACGAGCCACCTCCGAGCGATGCAGACC
TCGACCAGCGATGACGATACTCCCGGCCGAGACGAGACTGCCCCGTTACTGTCCGAAACCGCCCGTCTCCGAGCC
TCCCCTACCGGCTACCCGGGCTACGGCACCTCGGACCCGAGAGTCGGTCGGGTTCGAAGCCGCAGGGACTCCAGC
CGGTCGTCGAGGACCAAGCTCGGCGCCGTGTCGGCCATGAAAGACTCGTACGATGTCAATCACCCGCCCTCAGTC
CCCGGCTCGCCCACTTTTGGCGCCGCCGATCACCCGGAGATGGTCTTTGGCGATGTCATGATCAGGGACGAGCTG
TCGCTGCGCAGCGGCAGTCCCCGTTTCTCCCTCGACGCCGACGCCGACCTCTCCACCGCCGACGGCCCGGTCCGA
GACCACCGTCCTGACCATGGGCGGAGGCTCACCGTGTCCGGCTCCGGCGACGTGTGCTTCCCCGTCCGCGGAATG
TCCGAGCTCGGTGAGGAAGACGCCCACTCACGAGACCCCGAGCTGCACCAGTACAGAGCACGTCGTCGCCGCGGC
CAGTGGCCCGACCTGTCGACGCTGGAAGAGTGGAAGCGCTTCGAGAAGGAGGAGCACAGCGAGGAGAGGCGGGTC
AAGAAGATCACCGAGCCGCAGCTCATCAATGGCCGGCTTCGCCCGGTTCGCAAGGGCTGGTACCAGAGCGACGAC
GAAGCCCCTTACAGATTCACCTACTTTAACGAGGAATTTCAGAGCACCATACACAGCCCCACCATATCCGAGCTC
GTCCAACCGGGCAGCGACTTTCGGGAGCTCTTCATTCCGGATCCGCGCGTCCTGTCCGACGATGAGACCGACGAC
GAAGGCGAGACCATGTCGCCGCAGGTCAGACCTTACCCCACAAGGGGCGGCGATGGCGGATCCAGGACGCCGACG
CGGTTGCCGTCTTATGCAGATTCTCGCCGCGACGCCTTTGCCTCGCCGGCGCGGGACGTGGCCACACCCGTCATG
CCGGCCTCGGGCCGCGCGACGCCCCTGCCTGTCAGGTCTCCTGAACATGAGAACAAGGCGCAATCTCGCGATCGG
GAATCGGCCTCGACGACGAAGCCGGTTCGGTACGGAGACCGGCCGGTCTGGTGGCTCGACGTCCTCTGCCCGACA
GAGGCGGAGATGAAGGTCATCGCCAAGGCTTTTGGCATCCATCCCCTTACGGCCGAGGACATTATGGTGCAGGAG
GCCCGGGAAAAGGTCGAGCTGTTCCGGCACTACTACTTTGTCAACTATCGCACCTTCGACCAGGACCTCAACGGC
GGCAATGACCTCGAGCCCATCAACATGTACGTCGTCGTCTTCCGTGAGGGCGTGCTCAGCTTCCACTTCTCCATG
ACGCCTCACCCCGCCAACGTGCGGAGGCGAATCCGTCAGCTCAGAGACTACCTGATCCTCTCGTCCGACTGGATC
TCGTACGCCATCATCGACGACATTACCGACGTCTTCCAGCCCCTGATTCAGAACATCGAGGCCGAGGTGGACGAG
ATCGACGGCGAGATTCTTCAGCTGCACTCGTCGGCCGACAAGCGCATCAAAGACCAGAAAAACTCGGCCGGCAAC
GACGACAACGCCACGGCCATTGTCGACTCCAGTGACATGCTGCGCCGGGTCGGGGACTGCAGGAAGAGGGTCATG
AGCCTGTACCGCCTGCTCGGCAACAAGGCGGATGTCATCAAGGGCTTCGCGAAACGCTGCAACGAGCGGTGGGAA
GTTGCGCCGCGGTCCGAGATTGGCCTGTATCTGGGCGACATTCAGGATCATATAGTGACCATGACGTCGAACCTT
GGCCACTACGAGAAGATCCTGGCCCGGACGCACGCCAACTACCTAGCCCAGATCAACATTCGCATGAACGAGCGG
CAGGAACAGACTGCCGACGTTCTCGGCAGGCTCACGGTGCTGGGCACCATCGTGCTGCCCATGAACATCATAACC
GGCCTCTGGGGCATGAACGTCTGGGTCCCGGGCCAGCAGCACGAGGGAGACCTGAGCTGGTTCGTATGGATCACG
GTGGGCCTCGTCGGCTTCGGTCTCGCGTGCTACCTGATCGCCAAGCGGGTGTACAAAATTGTCTAG
Gene >Ophio5|5085
ATGTTTGGTGCCACAAACCCCGCATCCTCGTCGTCGACGGCTCCCGCAGTACCCGCACCGTCATCCGACCAGCAG
AAGTCTCGGACGGTGAGGAAGCGGAAGGGCCATCGCGGCGGAAAGAAGAAGCGCACGCGCAGGAAGAGCTTCGCC
GCTCTGACCGAGGATAGCCATGACGAGATGCATCACTCTCCGGCCGACGCTTTCTACCAGATGCCCGCCTCCAGC
CTCAGTGGCGCCAGCATCGACAGTGAGGCGCTTCTGGACCACAGGTGAGTCGGCCTCCCTCCAACCATCGATTGC
CTGCCTGCCTGCCTGCTCATCTATCTCCCCATCTATCCATCTACCTACCTACCTACCTATCTACCTACCCACCTC
TATTCTGACACTCGAGTTCAGGGACCAGAGGTCAATGCGCATTCGCAGGAGCTCCGTCGCCGCTTCCAGCGCTCT
ACACAATCCCTATGCCACGCCTGCTACGAGCCACCTCCGAGCGATGCAGACCTCGACCAGCGATGACGATACTCC
CGGCCGAGACGAGACTGCCCCGTTACTGTCCGAAACCGCCCGTCTCCGAGCCTCCCCTACCGGCTACCCGGGCTA
CGGCACCTCGGACCCGAGAGTCGGTCGGGTTCGAAGCCGCAGGGACTCCAGCCGGTCGTCGAGGACCAAGCTCGG
CGCCGTGTCGGCCATGAAAGACTCGTACGATGTCAATCACCCGCCCTCAGTCCCCGGCTCGCCCACTTTTGGCGC
CGCCGATCACCCGGAGATGGTCTTTGGCGATGTCATGATCAGGGACGAGCTGTCGCTGCGCAGCGGCAGTCCCCG
TTTCTCCCTCGACGCCGACGCCGACCTCTCCACCGCCGACGGCCCGGTCCGAGACCACCGTCCTGACCATGGGCG
GAGGCTCACCGTGTCCGGCTCCGGCGACGTGTGCTTCCCCGTCCGCGGAATGTCCGAGCTCGGTGAGGAAGACGC
CCACTCACGAGACCCCGAGCTGCACCAGTACAGAGCACGTCGTCGCCGCGGCCAGTGGCCCGACCTGTCGACGCT
GGAAGAGTGGAAGCGCTTCGAGAAGGAGGAGCACAGCGAGGAGAGGCGGGTCAAGAAGATCACCGAGCCGCAGCT
CATCAATGGCCGGCTTCGCCCGGTTCGCAAGGGCTGGTACCAGAGCGACGACGAAGCCCCTTACAGATTCACCTA
CTTTAACGAGGAATTTCAGAGCACCATACACAGCCCCACCATATCCGAGCTCGTCCAACCGGGCAGCGACTTTCG
GGAGCTCTTCATTCCGGATCCGCGCGTCCTGTCCGACGATGAGACCGACGACGAAGGCGAGACCATGTCGCCGCA
GGTCAGACCTTACCCCACAAGGGGCGGCGATGGCGGATCCAGGACGCCGACGCGGTTGCCGTCTTATGCAGATTC
TCGCCGCGACGCCTTTGCCTCGCCGGCGCGGGACGTGGCCACACCCGTCATGCCGGCCTCGGGCCGCGCGACGCC
CCTGCCTGTCAGGTCTCCTGAACATGAGAACAAGGCGCAATCTCGCGATCGGGAATCGGCCTCGACGACGAAGCC
GGTTCGGTACGGAGACCGGCCGGTCTGGTGGCTCGACGTCCTCTGCCCGACAGAGGCGGAGATGAAGGTCATCGC
CAAGGCTTTTGGCATCCATCCCCTTACGGCCGAGGACATTATGGTGCAGGAGGCCCGGGAAAAGGTCGAGCTGTT
CCGGCACTACTACTTTGTCAACTATCGCACCTTCGACCAGGACCTCAACGGCGGCAATGACCTCGAGCCCATCAA
CATGTACGTCGTCGTCTTCCGTGAGGGCGTGCTCAGCTTCCACTTCTCCATGACGCCTCACCCCGCCAACGTGCG
GAGGCGAATCCGTCAGCTCAGAGACTACCTGATCCTCTCGTCCGACTGGATCTCGTACGCCATCATCGACGACAT
TACCGACGTCTTCCAGCCCCTGATTCAGAACATCGAGGCCGAGGTGGACGAGATCGACGGCGAGATTCTTCAGCT
GCACTCGTCGGCCGACAAGCGCATCAAAGACCAGAAAAACTCGGCCGGCAACGACGACAACGCCACGGCCATTGT
CGACTCCAGTGACATGCTGCGCCGGGTCGGGGACTGCAGGAAGAGGGTCATGAGCCTGTACCGCCTGCTCGGCAA
CAAGGCGGATGTCATCAAGGGCTTCGCGAAACGCTGCAACGAGCGGTGGGAAGTTGCGCCGCGGTCCGAGATTGG
CCTGTATCTGGGCGACATTCAGGATCATATAGTGACCATGACGTCGAACCTTGGCCACTACGAGAAGTACGTCGA
ACTCCACTCCCTCACGACGACGCACACTGACCTGTCTCAGGATCCTGGCCCGGACGCACGCCAACTACCTAGCCC
AGATCAACATTCGCATGAACGAGCGGCAGGAACAGACTGCCGACGTTCTCGGCAGGCTCACGGTGCTGGGCACCA
TCGTGCTGCCCATGAACATCATAACCGGCCTCTGGGGCATGAACGTCTGGGTCCCGGGCCAGCAGCACGAGGGAG
ACCTGAGCTGGTTCGTATGGATCACGGTGGGCCTCGTCGGCTTCGGTCTCGCGTGCTACCTGATCGCCAAGCGGG
TGTACAAAATTGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail