Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5084
Gene name
Locationscaffold_409:16695..18871
Strand-
Gene length (bp)2176
Transcript length (bp)2082
Coding sequence length (bp)2079
Protein length (aa) 693

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 6.8E-53 85 454
PF16901 DAO_C C-terminal domain of alpha-glycerophosphate oxidase 8.6E-42 494 615

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6QLU1|GPDM_BOVIN Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Bos taurus GN=GPD2 PE=2 SV=1 5 626 0.0E+00
sp|P43304|GPDM_HUMAN Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Homo sapiens GN=GPD2 PE=1 SV=3 5 626 0.0E+00
sp|Q64521|GPDM_MOUSE Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Mus musculus GN=Gpd2 PE=1 SV=2 5 626 0.0E+00
sp|Q4R755|GPDM_MACFA Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Macaca fascicularis GN=GPD2 PE=2 SV=1 5 626 0.0E+00
sp|P35571|GPDM_RAT Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Gpd2 PE=1 SV=1 16 626 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6QLU1|GPDM_BOVIN Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Bos taurus GN=GPD2 PE=2 SV=1 5 626 0.0E+00
sp|P43304|GPDM_HUMAN Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Homo sapiens GN=GPD2 PE=1 SV=3 5 626 0.0E+00
sp|Q64521|GPDM_MOUSE Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Mus musculus GN=Gpd2 PE=1 SV=2 5 626 0.0E+00
sp|Q4R755|GPDM_MACFA Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Macaca fascicularis GN=GPD2 PE=2 SV=1 5 626 0.0E+00
sp|P35571|GPDM_RAT Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Gpd2 PE=1 SV=1 16 626 0.0E+00
sp|A7DZP8|GPDM_MESAU Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Mesocricetus auratus GN=GPD2 PE=1 SV=1 79 626 0.0E+00
sp|P90795|GPDM_CAEEL Probable glycerol-3-phosphate dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=T25G3.4 PE=3 SV=2 30 626 9.0E-168
sp|Q9SS48|SDP6_ARATH Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial OS=Arabidopsis thaliana GN=SDP6 PE=1 SV=1 52 629 3.0E-151
sp|Q8SR40|GPDH_ENCCU Probable glycerol-3-phosphate dehydrogenase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU10_0870 PE=3 SV=1 84 631 4.0E-146
sp|Q54QC1|GPDM_DICDI Probable glycerol-3-phosphate dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=DDB_G0283951 PE=3 SV=1 1 629 2.0E-145
sp|P32191|GPDM_YEAST Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUT2 PE=1 SV=2 83 631 3.0E-140
sp|O14400|GPDM_SCHPO Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gut2 PE=3 SV=1 76 643 2.0E-137
sp|Q5HPP0|GLPD_STAEQ Aerobic glycerol-3-phosphate dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=glpD PE=3 SV=1 68 616 4.0E-75
sp|Q8CPE6|GLPD_STAES Aerobic glycerol-3-phosphate dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=glpD PE=3 SV=1 68 616 4.0E-75
sp|Q2YXR5|GLPD_STAAB Aerobic glycerol-3-phosphate dehydrogenase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=glpD PE=3 SV=2 68 610 1.0E-72
sp|Q7A105|GLPD_STAAW Aerobic glycerol-3-phosphate dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=glpD PE=3 SV=2 68 610 2.0E-72
sp|Q6G9R2|GLPD_STAAS Aerobic glycerol-3-phosphate dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=glpD PE=3 SV=2 68 610 2.0E-72
sp|Q7A5V7|GLPD_STAAN Aerobic glycerol-3-phosphate dehydrogenase OS=Staphylococcus aureus (strain N315) GN=glpD PE=1 SV=2 68 610 2.0E-72
sp|Q99UH2|GLPD_STAAM Aerobic glycerol-3-phosphate dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=glpD PE=3 SV=2 68 610 2.0E-72
sp|Q5HGD1|GLPD_STAAC Aerobic glycerol-3-phosphate dehydrogenase OS=Staphylococcus aureus (strain COL) GN=glpD PE=3 SV=1 68 610 2.0E-72
sp|Q2FYZ4|GLPD_STAA8 Aerobic glycerol-3-phosphate dehydrogenase OS=Staphylococcus aureus (strain NCTC 8325) GN=glpD PE=3 SV=1 68 610 2.0E-72
sp|Q2FHD8|GLPD_STAA3 Aerobic glycerol-3-phosphate dehydrogenase OS=Staphylococcus aureus (strain USA300) GN=glpD PE=3 SV=1 68 610 2.0E-72
sp|Q49X94|GLPD_STAS1 Aerobic glycerol-3-phosphate dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=glpD PE=3 SV=1 68 610 3.0E-72
sp|Q6GHD4|GLPD_STAAR Aerobic glycerol-3-phosphate dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=glpD PE=3 SV=2 68 610 3.0E-72
sp|Q4L608|GLPD_STAHJ Aerobic glycerol-3-phosphate dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=glpD PE=3 SV=1 68 616 1.0E-71
sp|P9WN79|GLPD2_MYCTU Glycerol-3-phosphate dehydrogenase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glpD2 PE=1 SV=1 65 618 2.0E-69
sp|P64185|GLPD2_MYCBO Glycerol-3-phosphate dehydrogenase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glpD2 PE=3 SV=1 65 618 2.0E-69
sp|P9WN78|GLPD2_MYCTO Glycerol-3-phosphate dehydrogenase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glpD2 PE=3 SV=1 65 618 2.0E-69
sp|P53435|GLPD_MYCLE Glycerol-3-phosphate dehydrogenase OS=Mycobacterium leprae (strain TN) GN=glpD PE=3 SV=1 57 634 2.0E-68
sp|P74257|GLPD_SYNY3 Glycerol-3-phosphate dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=glpD PE=3 SV=1 80 633 2.0E-68
sp|P18158|GLPD_BACSU Aerobic glycerol-3-phosphate dehydrogenase OS=Bacillus subtilis (strain 168) GN=glpD PE=2 SV=2 84 632 2.0E-67
sp|P35596|GLPO_STRPN Alpha-glycerophosphate oxidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=glpO PE=3 SV=2 85 619 6.0E-58
sp|Q9CG65|GLPO_LACLA Alpha-glycerophosphate oxidase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=glpO PE=3 SV=1 72 635 9.0E-55
sp|Q99YI8|GLPO_STRP1 Alpha-glycerophosphate oxidase OS=Streptococcus pyogenes serotype M1 GN=glpO PE=3 SV=1 72 615 1.0E-51
sp|O86963|GLPO_ENTCA Alpha-glycerophosphate oxidase OS=Enterococcus casseliflavus GN=glpO PE=1 SV=3 84 615 2.0E-50
sp|P0DB21|GLPO_STRPQ Alpha-glycerophosphate oxidase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=glpO PE=3 SV=1 72 615 2.0E-50
sp|P0DB20|GLPO_STRP3 Alpha-glycerophosphate oxidase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=glpO PE=3 SV=1 72 615 2.0E-50
sp|Q8NZX0|GLPO_STRP8 Alpha-glycerophosphate oxidase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=glpO PE=3 SV=1 72 615 2.0E-50
sp|Q5XAK0|GLPO_STRP6 Alpha-glycerophosphate oxidase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=glpO PE=3 SV=1 72 618 8.0E-48
sp|P9WN81|GLPD1_MYCTU Glycerol-3-phosphate dehydrogenase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glpD1 PE=1 SV=1 99 592 6.0E-45
sp|P64183|GLPD1_MYCBO Glycerol-3-phosphate dehydrogenase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glpD1 PE=3 SV=1 99 592 6.0E-45
sp|P9WN80|GLPD1_MYCTO Glycerol-3-phosphate dehydrogenase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glpD1 PE=3 SV=1 99 592 6.0E-45
sp|P52111|GLPD_PSEAE Glycerol-3-phosphate dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glpD PE=3 SV=2 101 595 1.0E-36
sp|O83004|GLPD_PSETO Glycerol-3-phosphate dehydrogenase OS=Pseudomonas tolaasii GN=glpD PE=3 SV=1 84 601 1.0E-36
sp|P13035|GLPD_ECOLI Aerobic glycerol-3-phosphate dehydrogenase OS=Escherichia coli (strain K12) GN=glpD PE=1 SV=3 85 592 2.0E-35
sp|P0A9C2|GLPA_SHIFL Anaerobic glycerol-3-phosphate dehydrogenase subunit A OS=Shigella flexneri GN=glpA PE=3 SV=1 101 487 2.0E-15
sp|P0A9C0|GLPA_ECOLI Anaerobic glycerol-3-phosphate dehydrogenase subunit A OS=Escherichia coli (strain K12) GN=glpA PE=1 SV=1 101 487 2.0E-15
sp|P0A9C1|GLPA_ECO57 Anaerobic glycerol-3-phosphate dehydrogenase subunit A OS=Escherichia coli O157:H7 GN=glpA PE=3 SV=1 101 487 2.0E-15
sp|P43799|GLPA_HAEIN Anaerobic glycerol-3-phosphate dehydrogenase subunit A OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=glpA PE=3 SV=1 101 476 2.0E-14
sp|D4GYI2|GLPA1_HALVD Anaerobic glycerol-3-phosphate dehydrogenase subunit A1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=gpdA1 PE=1 SV=1 99 546 2.0E-13
sp|D4GQU6|GLPA2_HALVD Anaerobic glycerol-3-phosphate dehydrogenase subunit A2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=gpdA2 PE=1 SV=1 84 584 4.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 12 29 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5084
MPPRFSRALRPLGAVVAAGGGVVIATVGFRRHRQRSDHGRDAVMIRRDATGRILPPTFPSVADRAQQLAALRRSG
KSNEEDSEYDLIVIGGGATGSGIALDAVTRGLKVALVEGDDFSAGTSSKSTKLVHGGVRYLEKAVWNLDWAQLQL
VMEALRERRAFLDIAPHLSGSLPILLPLQRLWQAPYLWAGCKMYDLLAGSHALESSYMMSRTRALEACPLLRRDR
LVGALVYYDGQHNDSRMNVSLALTAALYGATVVNHVHVVGLEKDDNGRVRGVRVQDLLHGNADEAFTVRARGVVN
ATGPFTDAVERMDDPSRKPIVAPASGAHVMLPGSLCPNGMGILDAQSSDGRVVFVLPWQGKTVAGTTDNTCDVER
EPVARRDDVDFILAAVGKLLGPESAPTRDDVLATWSGIRPLVKDPDTAGKTEALVRSHLVTVSSSGLLTCTGGKW
TTYRQMAQDAVDEAIRVFDLKPRTMTLPDISGLGLPGITTDGTCRTRHVPVIGAHGYSPDLPSQLTEHYGVDNDI
AYHLSTNYGDRAWAVLSDPRPSAKTRLSPSFPFIEAEIRYAVRHEAACTAADVISRRMRLSFLDVDQALQALPRV
IDVMADELGWPRSRRHREWNATVRFLRSMGLPEDKLDVTRDHVLSRLAKPPPRPTKSSLPGPETPSEASIGGART
REDKAAAGEGSRQLAPEA
Coding >Ophio5|5084
ATGCCGCCGCGCTTCTCGCGGGCTCTGCGCCCCCTCGGCGCCGTCGTCGCAGCAGGAGGAGGCGTCGTCATCGCC
ACGGTCGGATTCCGTCGTCATCGGCAAAGGTCGGATCATGGACGCGACGCGGTGATGATCAGACGCGATGCCACT
GGTCGAATCCTTCCACCTACCTTTCCCTCTGTGGCTGATCGGGCGCAACAGCTGGCGGCTCTTAGACGCAGCGGC
AAAAGCAACGAGGAGGATTCGGAATATGATCTCATCGTCATTGGCGGTGGCGCTACGGGTTCCGGTATCGCCCTC
GACGCCGTTACTCGTGGCCTCAAGGTCGCCCTCGTCGAAGGCGATGACTTTTCTGCCGGCACGAGCTCCAAGAGT
ACCAAGCTGGTACACGGCGGCGTGCGATATCTCGAAAAAGCAGTATGGAATCTCGATTGGGCACAGCTTCAGCTC
GTCATGGAAGCCCTACGCGAACGAAGGGCTTTTCTCGACATTGCCCCCCATCTGTCCGGCTCCTTACCCATCCTC
CTGCCTCTGCAGAGACTGTGGCAAGCTCCCTACCTCTGGGCCGGATGCAAAATGTACGACTTGCTGGCTGGCTCG
CACGCGCTCGAGAGCTCGTACATGATGAGTCGGACCAGGGCCTTGGAGGCCTGTCCCTTACTGAGGAGGGATAGG
CTCGTCGGCGCCCTGGTCTACTACGATGGACAGCACAACGACTCGCGCATGAACGTCTCGCTTGCCTTGACGGCC
GCTCTCTACGGCGCCACCGTTGTCAATCATGTCCATGTCGTTGGGCTGGAAAAGGATGACAACGGGAGGGTTCGA
GGCGTGCGCGTCCAGGATCTTCTCCATGGGAATGCTGACGAGGCCTTTACCGTACGAGCTCGGGGCGTCGTCAAC
GCCACCGGTCCTTTTACCGACGCTGTTGAGCGCATGGATGATCCGAGTCGAAAGCCCATCGTCGCCCCGGCTTCG
GGAGCCCACGTCATGCTGCCGGGTTCGCTGTGTCCCAACGGTATGGGCATCCTCGACGCTCAGTCGTCTGACGGT
CGCGTCGTTTTCGTTCTTCCCTGGCAGGGTAAGACGGTCGCCGGCACGACGGATAATACCTGCGACGTTGAGCGC
GAACCTGTCGCGCGTCGCGATGACGTCGACTTTATTCTCGCCGCCGTTGGCAAGCTGTTGGGCCCGGAGTCGGCG
CCGACGCGTGACGATGTGCTGGCCACCTGGTCCGGCATCCGTCCCCTCGTCAAAGACCCCGACACCGCCGGCAAG
ACCGAGGCTCTCGTCCGCAGCCACCTCGTCACCGTCTCATCCTCGGGCCTACTCACCTGCACCGGCGGCAAGTGG
ACAACATACCGACAAATGGCCCAAGACGCCGTCGACGAAGCCATCCGCGTCTTCGACCTCAAGCCCCGCACCATG
ACCCTCCCAGACATCAGCGGCCTCGGCCTCCCAGGCATCACCACCGACGGCACATGCCGTACGCGCCATGTCCCC
GTCATCGGCGCCCACGGCTACTCTCCCGACCTACCGAGTCAGCTAACGGAACACTACGGCGTCGACAACGACATC
GCGTACCACCTGTCGACCAACTACGGCGACCGAGCCTGGGCCGTCCTCTCCGACCCGCGCCCCTCGGCCAAGACG
CGTCTCTCGCCCTCGTTTCCCTTCATCGAAGCTGAGATCCGATACGCGGTCCGACACGAAGCCGCATGCACGGCG
GCCGACGTCATCTCTCGCCGAATGCGTCTATCCTTCCTCGACGTCGACCAAGCTCTTCAAGCCCTCCCGCGCGTC
ATCGATGTCATGGCCGATGAGCTCGGCTGGCCAAGGTCCCGACGCCATCGCGAGTGGAACGCTACCGTTCGCTTC
CTCCGCAGTATGGGCTTGCCTGAAGACAAGCTGGATGTCACCAGGGACCATGTTCTAAGTCGGCTTGCCAAGCCT
CCTCCTCGACCGACCAAGTCGTCTCTCCCTGGACCGGAGACGCCCTCGGAGGCGAGCATTGGTGGCGCGAGGACG
AGGGAGGACAAGGCTGCTGCAGGTGAAGGGAGCCGCCAGCTGGCTCCGGAGGCC
Transcript >Ophio5|5084
ATGCCGCCGCGCTTCTCGCGGGCTCTGCGCCCCCTCGGCGCCGTCGTCGCAGCAGGAGGAGGCGTCGTCATCGCC
ACGGTCGGATTCCGTCGTCATCGGCAAAGGTCGGATCATGGACGCGACGCGGTGATGATCAGACGCGATGCCACT
GGTCGAATCCTTCCACCTACCTTTCCCTCTGTGGCTGATCGGGCGCAACAGCTGGCGGCTCTTAGACGCAGCGGC
AAAAGCAACGAGGAGGATTCGGAATATGATCTCATCGTCATTGGCGGTGGCGCTACGGGTTCCGGTATCGCCCTC
GACGCCGTTACTCGTGGCCTCAAGGTCGCCCTCGTCGAAGGCGATGACTTTTCTGCCGGCACGAGCTCCAAGAGT
ACCAAGCTGGTACACGGCGGCGTGCGATATCTCGAAAAAGCAGTATGGAATCTCGATTGGGCACAGCTTCAGCTC
GTCATGGAAGCCCTACGCGAACGAAGGGCTTTTCTCGACATTGCCCCCCATCTGTCCGGCTCCTTACCCATCCTC
CTGCCTCTGCAGAGACTGTGGCAAGCTCCCTACCTCTGGGCCGGATGCAAAATGTACGACTTGCTGGCTGGCTCG
CACGCGCTCGAGAGCTCGTACATGATGAGTCGGACCAGGGCCTTGGAGGCCTGTCCCTTACTGAGGAGGGATAGG
CTCGTCGGCGCCCTGGTCTACTACGATGGACAGCACAACGACTCGCGCATGAACGTCTCGCTTGCCTTGACGGCC
GCTCTCTACGGCGCCACCGTTGTCAATCATGTCCATGTCGTTGGGCTGGAAAAGGATGACAACGGGAGGGTTCGA
GGCGTGCGCGTCCAGGATCTTCTCCATGGGAATGCTGACGAGGCCTTTACCGTACGAGCTCGGGGCGTCGTCAAC
GCCACCGGTCCTTTTACCGACGCTGTTGAGCGCATGGATGATCCGAGTCGAAAGCCCATCGTCGCCCCGGCTTCG
GGAGCCCACGTCATGCTGCCGGGTTCGCTGTGTCCCAACGGTATGGGCATCCTCGACGCTCAGTCGTCTGACGGT
CGCGTCGTTTTCGTTCTTCCCTGGCAGGGTAAGACGGTCGCCGGCACGACGGATAATACCTGCGACGTTGAGCGC
GAACCTGTCGCGCGTCGCGATGACGTCGACTTTATTCTCGCCGCCGTTGGCAAGCTGTTGGGCCCGGAGTCGGCG
CCGACGCGTGACGATGTGCTGGCCACCTGGTCCGGCATCCGTCCCCTCGTCAAAGACCCCGACACCGCCGGCAAG
ACCGAGGCTCTCGTCCGCAGCCACCTCGTCACCGTCTCATCCTCGGGCCTACTCACCTGCACCGGCGGCAAGTGG
ACAACATACCGACAAATGGCCCAAGACGCCGTCGACGAAGCCATCCGCGTCTTCGACCTCAAGCCCCGCACCATG
ACCCTCCCAGACATCAGCGGCCTCGGCCTCCCAGGCATCACCACCGACGGCACATGCCGTACGCGCCATGTCCCC
GTCATCGGCGCCCACGGCTACTCTCCCGACCTACCGAGTCAGCTAACGGAACACTACGGCGTCGACAACGACATC
GCGTACCACCTGTCGACCAACTACGGCGACCGAGCCTGGGCCGTCCTCTCCGACCCGCGCCCCTCGGCCAAGACG
CGTCTCTCGCCCTCGTTTCCCTTCATCGAAGCTGAGATCCGATACGCGGTCCGACACGAAGCCGCATGCACGGCG
GCCGACGTCATCTCTCGCCGAATGCGTCTATCCTTCCTCGACGTCGACCAAGCTCTTCAAGCCCTCCCGCGCGTC
ATCGATGTCATGGCCGATGAGCTCGGCTGGCCAAGGTCCCGACGCCATCGCGAGTGGAACGCTACCGTTCGCTTC
CTCCGCAGTATGGGCTTGCCTGAAGACAAGCTGGATGTCACCAGGGACCATGTTCTAAGTCGGCTTGCCAAGCCT
CCTCCTCGACCGACCAAGTCGTCTCTCCCTGGACCGGAGACGCCCTCGGAGGCGAGCATTGGTGGCGCGAGGACG
AGGGAGGACAAGGCTGCTGCAGGTGAAGGGAGCCGCCAGCTGGCTCCGGAGGCCTGA
Gene >Ophio5|5084
ATGCCGCCGCGCTTCTCGCGGGCTCTGCGCCCCCTCGGCGCCGTCGTCGCAGCAGGAGGAGGCGTCGTCATCGCC
ACGGTCGGATTCCGTCGTCATCGGCAAAGGTCGGATCATGGACGCGACGCGGTGATGATCAGACGCGATGCCACT
GGTCGAATCCTTCCACCTACCTTTCCCTCTGTGGCTGATCGGGCGCAACAGCTGGCGGCTCTTAGACGCAGCGGC
AAAAGCAACGAGGAGGATTCGGAATATGATCTCATCGTCATTGGCGGTGGCGCTACGGGTTCCGGTATCGCCCTC
GACGCCGTTACTCGTGGCCTCAAGGTCGCCCTCGTCGAAGGCGATGACTTTTCTGCCGGCACGAGCTCCAAGAGT
ACCAAGCTGGTACACGGCGGCGTGCGATATCTCGAAAAAGCAGTATGGAATCTCGATTGGGCACAGCTTCAGCTC
GTCATGGAAGCCCTACGCGAACGAAGGGCTTTTCTCGACATTGCCCCCCATCTGTCCGGCTCCTTACCCATCCTC
CTGCCTCTGCAGAGACTGTGGCAAGCTCCCTACCTCTGGGCCGGATGCAAAATGTACGACTTGCTGGCTGGCTCG
CACGCGCTCGAGAGCTCGTACATGATGAGTCGGACCAGGGCCTTGGAGGCCTGTCCCTTACTGAGGAGGGATAGG
CTCGTCGGCGCCCTGGTCTACTACGATGGACAGCACAACGACTCGCGCATGAACGTCTCGCTTGCCTTGACGGCC
GCTCTCTACGGCGCCACCGTTGTCAATCATGTCCATGTCGTTGGGCTGGAAAAGGATGACAACGGGAGGGTTCGA
GGCGTGCGCGTCCAGGATCTTCTCCATGGGAATGCTGACGAGGCCTTTACCGTACGAGCTCGGGGCGTCGTCAAC
GCCACCGGTCCTTTTACCGACGCTGTTGAGCGCATGGATGATCCGAGTCGAAAGCCCATCGTCGCCCCGGCTTCG
GGAGCCCACGTCATGCTGCCGGGTTCGCTGTGTCCCAACGGTATGGGCATCCTCGACGCTCAGTCGTCTGACGGT
CGCGTCGTTTTCGTTCTTCCCTGGCAGGGTAAGACGGTCGCCGGCACGACGGATAATACCTGCGACGTTGAGCGC
GAACCTGTCGCGCGTCGCGATGACGTCGACTTTATTCTCGCCGCCGTTGGCAAGCTGTTGGGCCCGGAGTCGGCG
CCGACGCGTGACGATGTGCTGGCCACCTGGTCCGGTTCGTGCTTCTCTATTCTCTCTCTCTCTCTCTCTCTCTCT
CTCTCTCCCCCCCCCCCCTTTCTTCTGATATAATCCTAAAACTTCAAGGCCAGGCATCCGTCCCCTCGTCAAAGA
CCCCGACACCGCCGGCAAGACCGAGGCTCTCGTCCGCAGCCACCTCGTCACCGTCTCATCCTCGGGCCTACTCAC
CTGCACCGGCGGCAAGTGGACAACATACCGACAAATGGCCCAAGACGCCGTCGACGAAGCCATCCGCGTCTTCGA
CCTCAAGCCCCGCACCATGACCCTCCCAGACATCAGCGGCCTCGGCCTCCCAGGCATCACCACCGACGGCACATG
CCGTACGCGCCATGTCCCCGTCATCGGCGCCCACGGCTACTCTCCCGACCTACCGAGTCAGCTAACGGAACACTA
CGGCGTCGACAACGACATCGCGTACCACCTGTCGACCAACTACGGCGACCGAGCCTGGGCCGTCCTCTCCGACCC
GCGCCCCTCGGCCAAGACGCGTCTCTCGCCCTCGTTTCCCTTCATCGAAGCTGAGATCCGATACGCGGTCCGACA
CGAAGCCGCATGCACGGCGGCCGACGTCATCTCTCGCCGAATGCGTCTATCCTTCCTCGACGTCGACCAAGCTCT
TCAAGCCCTCCCGCGCGTCATCGATGTCATGGCCGATGAGCTCGGCTGGCCAAGGTCCCGACGCCATCGCGAGTG
GAACGCTACCGTTCGCTTCCTCCGCAGTATGGGCTTGCCTGAAGACAAGCTGGATGTCACCAGGGACCATGTTCT
AAGTCGGCTTGCCAAGCCTCCTCCTCGACCGACCAAGTCGTCTCTCCCTGGACCGGAGACGCCCTCGGAGGCGAG
CATTGGTGGCGCGAGGACGAGGGAGGACAAGGCTGCTGCAGGTGAAGGGAGCCGCCAGCTGGCTCCGGAGGCCTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail