Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5081
Gene name
Locationscaffold_409:3303..4625
Strand+
Gene length (bp)1322
Transcript length (bp)1221
Coding sequence length (bp)1218
Protein length (aa) 406

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01501 Glyco_transf_8 Glycosyl transferase family 8 2.7E-09 104 369

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9XGN4|GOLS1_AJURE Galactinol synthase 1 OS=Ajuga reptans GN=GOLS1 PE=1 SV=1 102 404 2.0E-15
sp|O22893|GOLS1_ARATH Galactinol synthase 1 OS=Arabidopsis thaliana GN=GOLS1 PE=1 SV=1 88 385 3.0E-15
sp|Q9FXB2|GOLS2_ARATH Galactinol synthase 2 OS=Arabidopsis thaliana GN=GOLS2 PE=1 SV=1 75 391 8.0E-15
sp|O80518|GOLS3_ARATH Galactinol synthase 3 OS=Arabidopsis thaliana GN=GOLS3 PE=1 SV=1 102 391 2.0E-14
sp|Q8H1S1|GOLS6_ARATH Galactinol synthase 6 OS=Arabidopsis thaliana GN=GOLS6 PE=2 SV=1 80 372 6.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9XGN4|GOLS1_AJURE Galactinol synthase 1 OS=Ajuga reptans GN=GOLS1 PE=1 SV=1 102 404 2.0E-15
sp|O22893|GOLS1_ARATH Galactinol synthase 1 OS=Arabidopsis thaliana GN=GOLS1 PE=1 SV=1 88 385 3.0E-15
sp|Q9FXB2|GOLS2_ARATH Galactinol synthase 2 OS=Arabidopsis thaliana GN=GOLS2 PE=1 SV=1 75 391 8.0E-15
sp|O80518|GOLS3_ARATH Galactinol synthase 3 OS=Arabidopsis thaliana GN=GOLS3 PE=1 SV=1 102 391 2.0E-14
sp|Q8H1S1|GOLS6_ARATH Galactinol synthase 6 OS=Arabidopsis thaliana GN=GOLS6 PE=2 SV=1 80 372 6.0E-14
sp|C7G304|GOLS2_SOLLC Galactinol synthase 2 OS=Solanum lycopersicum GN=GOLS2 PE=2 SV=1 81 385 2.0E-13
sp|Q4PSY4|GOLS7_ARATH Galactinol synthase 7 OS=Arabidopsis thaliana GN=GOLS7 PE=2 SV=1 102 391 4.0E-13
sp|Q9FFA1|GOLS5_ARATH Galactinol synthase 5 OS=Arabidopsis thaliana GN=GOLS5 PE=2 SV=1 102 385 7.0E-13
sp|Q5UNW1|YR707_MIMIV Uncharacterized protein R707 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R707 PE=4 SV=1 102 370 1.0E-11
sp|F4KED2|GOLSA_ARATH Galactinol synthase 10 OS=Arabidopsis thaliana GN=GOLS10 PE=3 SV=1 94 385 3.0E-10
sp|Q9XGN3|GOLS2_AJURE Galactinol synthase 2 (Fragment) OS=Ajuga reptans GN=GOLS2 PE=1 SV=1 124 404 4.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5081
MVWVRPGMVLDAHVTLSSSTWLIPIIVDNTHLTSPCPHLAFTLTTPQPLSPSAPPPAAPTSSSHTIPPPPKKNMP
RTSDQFSLPPNSSMPSNTPIDSDRVWTSLITNLNYLPALLTLNYSLRHRAKSSYPLLALYTDSFPEQGRSALARR
DIPARRIPYLLPTESRDYSHDPRFYDCWSKLAPFSLTEFKRVVQLDADMLVLRNMDELMTLALDQPPTEIGDAPS
GNRVFAAGHACVCNPLRKSHYPSDWTPQNCAFSSQHSDPEAAQTVAPDPAVGPLGFMNGGLQVVNPSNVLYAQIV
AHMEADAVNMDFADQSLLSDLYRGRWLPLPYVYNALKTMRWQGVHDAIWRDDEVKNVHYILSPKPWDEMDQQGNW
TGSDETHRWWVDVNRERKAAEREQNIPDDGF
Coding >Ophio5|5081
ATGGTGTGGGTTCGTCCTGGAATGGTCCTAGACGCACACGTGACCTTATCGTCGTCAACTTGGTTGATCCCTATC
ATCGTCGATAACACACACCTCACCTCACCTTGCCCTCACCTGGCCTTCACCCTCACCACACCTCAACCTCTCTCC
CCATCAGCACCACCACCAGCAGCACCCACCTCCTCCTCCCACACCATCCCTCCCCCCCCAAAAAAAAACATGCCA
AGAACCAGCGACCAATTCTCTCTCCCACCCAACTCCAGCATGCCCTCCAATACCCCCATAGACTCAGACCGAGTC
TGGACAAGCCTCATCACGAACCTCAACTACCTTCCCGCCCTGCTAACCCTGAATTACTCGCTCCGCCACCGCGCC
AAATCATCGTACCCGCTTCTGGCCCTCTACACCGACTCCTTTCCGGAACAAGGACGGTCGGCGCTCGCACGGCGC
GATATCCCCGCCCGACGAATCCCTTATCTGCTCCCGACGGAATCGCGCGATTATTCTCATGATCCGCGCTTTTAT
GATTGCTGGTCCAAGCTTGCGCCTTTTTCCTTGACGGAATTCAAGCGTGTCGTTCAGTTGGATGCGGATATGCTC
GTGTTGAGGAATATGGATGAGCTCATGACCCTGGCTTTGGATCAGCCTCCTACAGAAATTGGCGACGCGCCGTCG
GGGAACCGTGTCTTCGCTGCTGGGCACGCTTGCGTCTGTAATCCGCTTCGCAAGTCGCATTATCCGTCCGATTGG
ACCCCTCAGAATTGCGCCTTCTCCTCGCAACACTCTGACCCCGAAGCCGCTCAGACGGTCGCTCCGGACCCGGCC
GTCGGGCCGCTAGGCTTCATGAACGGTGGCCTGCAGGTCGTCAATCCGTCAAACGTCTTGTACGCCCAGATCGTC
GCGCACATGGAGGCCGACGCCGTCAACATGGACTTTGCCGACCAGTCCCTCCTGTCCGATCTCTATCGCGGCCGT
TGGCTGCCCCTCCCTTACGTCTACAACGCCCTCAAGACTATGCGCTGGCAGGGAGTTCACGACGCCATCTGGCGG
GACGACGAGGTCAAGAACGTCCACTACATCCTCAGCCCCAAGCCCTGGGACGAGATGGACCAACAGGGAAACTGG
ACCGGCTCCGACGAGACCCATCGTTGGTGGGTCGACGTCAACCGCGAAAGGAAGGCCGCCGAGAGGGAGCAGAAT
ATTCCCGATGATGGGTTC
Transcript >Ophio5|5081
ATGGTGTGGGTTCGTCCTGGAATGGTCCTAGACGCACACGTGACCTTATCGTCGTCAACTTGGTTGATCCCTATC
ATCGTCGATAACACACACCTCACCTCACCTTGCCCTCACCTGGCCTTCACCCTCACCACACCTCAACCTCTCTCC
CCATCAGCACCACCACCAGCAGCACCCACCTCCTCCTCCCACACCATCCCTCCCCCCCCAAAAAAAAACATGCCA
AGAACCAGCGACCAATTCTCTCTCCCACCCAACTCCAGCATGCCCTCCAATACCCCCATAGACTCAGACCGAGTC
TGGACAAGCCTCATCACGAACCTCAACTACCTTCCCGCCCTGCTAACCCTGAATTACTCGCTCCGCCACCGCGCC
AAATCATCGTACCCGCTTCTGGCCCTCTACACCGACTCCTTTCCGGAACAAGGACGGTCGGCGCTCGCACGGCGC
GATATCCCCGCCCGACGAATCCCTTATCTGCTCCCGACGGAATCGCGCGATTATTCTCATGATCCGCGCTTTTAT
GATTGCTGGTCCAAGCTTGCGCCTTTTTCCTTGACGGAATTCAAGCGTGTCGTTCAGTTGGATGCGGATATGCTC
GTGTTGAGGAATATGGATGAGCTCATGACCCTGGCTTTGGATCAGCCTCCTACAGAAATTGGCGACGCGCCGTCG
GGGAACCGTGTCTTCGCTGCTGGGCACGCTTGCGTCTGTAATCCGCTTCGCAAGTCGCATTATCCGTCCGATTGG
ACCCCTCAGAATTGCGCCTTCTCCTCGCAACACTCTGACCCCGAAGCCGCTCAGACGGTCGCTCCGGACCCGGCC
GTCGGGCCGCTAGGCTTCATGAACGGTGGCCTGCAGGTCGTCAATCCGTCAAACGTCTTGTACGCCCAGATCGTC
GCGCACATGGAGGCCGACGCCGTCAACATGGACTTTGCCGACCAGTCCCTCCTGTCCGATCTCTATCGCGGCCGT
TGGCTGCCCCTCCCTTACGTCTACAACGCCCTCAAGACTATGCGCTGGCAGGGAGTTCACGACGCCATCTGGCGG
GACGACGAGGTCAAGAACGTCCACTACATCCTCAGCCCCAAGCCCTGGGACGAGATGGACCAACAGGGAAACTGG
ACCGGCTCCGACGAGACCCATCGTTGGTGGGTCGACGTCAACCGCGAAAGGAAGGCCGCCGAGAGGGAGCAGAAT
ATTCCCGATGATGGGTTCTAG
Gene >Ophio5|5081
ATGGTGTGGGTTCGTCCTGGAATGGTCCTAGACGCACACGTGACCTTATCGTCGTCAACTTGGTTGATCCCTATC
ATCGTCGATAACACACACCTCACCTCACCTTGCCCTCACCTGGCCTTCACCCTCACCACACCTCAACCTCTCTCC
CCATCAGCACCACCACCAGCAGCACCCACCTCCTCCTCCCACACCATCCCTCCCCCCCCAAAAAAAAACATGCCA
AGAACCAGCGACCAATTCTCTCTCCCACCCAACTCCAGCATGCCCTCCAATACCCCCATAGACTCAGACCGAGGT
AGACATCTCCTCCTCTCTCTCCCGCTCCCGAAATATATACCCCGTCCACCATCTAACGAAGGAAAAAAAAAAAAA
AAAAAAAAACACAAACCCCTTCAGTCTGGACAAGCCTCATCACGAACCTCAACTACCTTCCCGCCCTGCTAACCC
TGAATTACTCGCTCCGCCACCGCGCCAAATCATCGTACCCGCTTCTGGCCCTCTACACCGACTCCTTTCCGGAAC
AAGGACGGTCGGCGCTCGCACGGCGCGATATCCCCGCCCGACGAATCCCTTATCTGCTCCCGACGGAATCGCGCG
ATTATTCTCATGATCCGCGCTTTTATGATTGCTGGTCCAAGCTTGCGCCTTTTTCCTTGACGGAATTCAAGCGTG
TCGTTCAGTTGGATGCGGATATGCTCGTGTTGAGGAATATGGATGAGCTCATGACCCTGGCTTTGGATCAGCCTC
CTACAGAAATTGGCGACGCGCCGTCGGGGAACCGTGTCTTCGCTGCTGGGCACGCTTGCGTCTGTAATCCGCTTC
GCAAGTCGCATTATCCGTCCGATTGGACCCCTCAGAATTGCGCCTTCTCCTCGCAACACTCTGACCCCGAAGCCG
CTCAGACGGTCGCTCCGGACCCGGCCGTCGGGCCGCTAGGCTTCATGAACGGTGGCCTGCAGGTCGTCAATCCGT
CAAACGTCTTGTACGCCCAGATCGTCGCGCACATGGAGGCCGACGCCGTCAACATGGACTTTGCCGACCAGTCCC
TCCTGTCCGATCTCTATCGCGGCCGTTGGCTGCCCCTCCCTTACGTCTACAACGCCCTCAAGACTATGCGCTGGC
AGGGAGTTCACGACGCCATCTGGCGGGACGACGAGGTCAAGAACGTCCACTACATCCTCAGCCCCAAGCCCTGGG
ACGAGATGGACCAACAGGGAAACTGGACCGGCTCCGACGAGACCCATCGTTGGTGGGTCGACGTCAACCGCGAAA
GGAAGGCCGCCGAGAGGGAGCAGAATATTCCCGATGATGGGTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail