Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5077
Gene name
Locationscaffold_408:15427..16996
Strand+
Gene length (bp)1569
Transcript length (bp)1500
Coding sequence length (bp)1497
Protein length (aa) 499

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 5.1E-85 14 486
PF07690 MFS_1 Major Facilitator Superfamily 2.5E-30 69 439
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 4.0E-08 76 209

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38142|YB91_YEAST Probable metabolite transport protein YBR241C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR241C PE=1 SV=1 6 495 2.0E-82
sp|P53142|VPS73_YEAST Vacuolar protein sorting-associated protein 73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS73 PE=1 SV=1 4 483 1.0E-73
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 69 499 7.0E-55
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 2 497 1.0E-50
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 4 489 6.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38142|YB91_YEAST Probable metabolite transport protein YBR241C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR241C PE=1 SV=1 6 495 2.0E-82
sp|P53142|VPS73_YEAST Vacuolar protein sorting-associated protein 73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS73 PE=1 SV=1 4 483 1.0E-73
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 69 499 7.0E-55
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 2 497 1.0E-50
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 4 489 6.0E-50
sp|P11169|GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens GN=SLC2A3 PE=1 SV=1 1 489 1.0E-49
sp|P47842|GTR3_CANLF Solute carrier family 2, facilitated glucose transporter member 3 OS=Canis lupus familiaris GN=SLC2A3 PE=2 SV=1 1 485 1.0E-49
sp|Q5R608|GTR3_PONAB Solute carrier family 2, facilitated glucose transporter member 3 OS=Pongo abelii GN=SLC2A3 PE=2 SV=1 1 489 3.0E-49
sp|Q8TDB8|GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens GN=SLC2A14 PE=2 SV=1 5 489 9.0E-49
sp|Q90592|GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus GN=SLC2A2 PE=2 SV=1 2 499 4.0E-48
sp|P11168|GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens GN=SLC2A2 PE=1 SV=1 1 499 1.0E-47
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 67 491 1.0E-47
sp|P47843|GTR3_SHEEP Solute carrier family 2, facilitated glucose transporter member 3 OS=Ovis aries GN=SLC2A3 PE=2 SV=1 1 485 2.0E-47
sp|P32037|GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 1 489 7.0E-47
sp|Q07647|GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus GN=Slc2a3 PE=1 SV=1 1 489 8.0E-47
sp|P13355|GTR1_RABIT Solute carrier family 2, facilitated glucose transporter member 1 OS=Oryctolagus cuniculus GN=SLC2A1 PE=2 SV=1 2 497 8.0E-47
sp|P58352|GTR3_BOVIN Solute carrier family 2, facilitated glucose transporter member 3 OS=Bos taurus GN=SLC2A3 PE=2 SV=1 1 485 2.0E-46
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus GN=Slc2a2 PE=2 SV=1 1 498 2.0E-46
sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens GN=SLC2A1 PE=1 SV=2 2 497 2.0E-46
sp|P27674|GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus GN=SLC2A1 PE=1 SV=1 4 497 7.0E-46
sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 49 497 1.0E-45
sp|P17809|GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus GN=Slc2a1 PE=1 SV=4 2 497 2.0E-45
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 22 491 3.0E-45
sp|P20303|GTR1_PIG Solute carrier family 2, facilitated glucose transporter member 1 OS=Sus scrofa GN=SLC2A1 PE=2 SV=2 2 497 3.0E-45
sp|A9ZSY2|TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica GN=Tret1 PE=1 SV=1 77 495 3.0E-45
sp|P11167|GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus GN=Slc2a1 PE=1 SV=1 2 497 4.0E-45
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 72 485 8.0E-45
sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 45 491 9.0E-45
sp|Q9FRL3|ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1 4 496 2.0E-44
sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 60 491 4.0E-44
sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 45 491 6.0E-44
sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 72 498 1.0E-43
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 1 498 2.0E-43
sp|Q27994|GTR4_BOVIN Solute carrier family 2, facilitated glucose transporter member 4 OS=Bos taurus GN=SLC2A4 PE=2 SV=2 4 498 3.0E-43
sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 77 491 9.0E-43
sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 67 491 5.0E-42
sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 100 497 3.0E-41
sp|P14672|GTR4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 OS=Homo sapiens GN=SLC2A4 PE=1 SV=1 4 498 4.0E-41
sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 4 496 6.0E-41
sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 45 497 2.0E-40
sp|P14142|GTR4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus GN=Slc2a4 PE=1 SV=3 4 498 2.0E-40
sp|P58351|GTR2_BOVIN Solute carrier family 2, facilitated glucose transporter member 2 OS=Bos taurus GN=SLC2A2 PE=2 SV=2 1 446 2.0E-40
sp|Q7PIR5|TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae GN=Tret1 PE=1 SV=3 100 497 4.0E-40
sp|P19357|GTR4_RAT Solute carrier family 2, facilitated glucose transporter member 4 OS=Rattus norvegicus GN=Slc2a4 PE=1 SV=1 4 498 4.0E-40
sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 91 497 4.0E-40
sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 100 497 8.0E-40
sp|Q8IRI6|GTR1_DROME Glucose transporter type 1 OS=Drosophila melanogaster GN=Glut1 PE=2 SV=4 6 499 1.0E-39
sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 91 497 1.0E-39
sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 91 497 1.0E-39
sp|Q94CI7|EDL17_ARATH Sugar transporter ERD6-like 17 OS=Arabidopsis thaliana GN=SFP1 PE=2 SV=2 67 484 1.0E-39
sp|Q9LT15|STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1 6 495 2.0E-39
sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 91 497 2.0E-39
sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 100 497 4.0E-39
sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 94 497 5.0E-39
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 67 495 5.0E-39
sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 67 485 5.0E-39
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 6 495 7.0E-39
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 67 499 8.0E-39
sp|P23586|STP1_ARATH Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2 5 492 9.0E-39
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 67 498 1.0E-38
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 67 492 1.0E-38
sp|Q8VZT3|EDL12_ARATH Sugar transporter ERD6-like 12 OS=Arabidopsis thaliana GN=SUGTL5 PE=2 SV=1 67 491 2.0E-38
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 85 485 3.0E-38
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 77 489 5.0E-38
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 5 495 6.0E-38
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 67 495 8.0E-38
sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 67 484 1.0E-37
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 14 491 6.0E-37
sp|A1Z8N1|TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster GN=Tret1-1 PE=1 SV=1 100 497 6.0E-37
sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 91 497 6.0E-37
sp|B4J913|TRET1_DROGR Facilitated trehalose transporter Tret1 OS=Drosophila grimshawi GN=Tret1 PE=3 SV=1 18 497 2.0E-36
sp|A5LGM7|TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki GN=Tret1 PE=1 SV=1 91 497 3.0E-36
sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 91 497 5.0E-36
sp|P0C6A1|GTR7_MOUSE Solute carrier family 2, facilitated glucose transporter member 7 OS=Mus musculus GN=Slc2a7 PE=3 SV=1 23 489 6.0E-36
sp|Q0WQ63|ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1 67 491 1.0E-35
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 77 483 5.0E-35
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 77 483 5.0E-35
sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 67 485 7.0E-35
sp|Q9XSC2|GTR3_RABIT Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Oryctolagus cuniculus GN=SLC2A3 PE=2 SV=1 122 489 1.0E-34
sp|P58354|GTR8_BOVIN Solute carrier family 2, facilitated glucose transporter member 8 OS=Bos taurus GN=SLC2A8 PE=2 SV=2 97 485 1.0E-34
sp|O65413|STP12_ARATH Sugar transport protein 12 OS=Arabidopsis thaliana GN=STP12 PE=2 SV=1 5 492 1.0E-34
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 5 495 1.0E-34
sp|O44827|FGT1_CAEEL Facilitated glucose transporter protein 1 OS=Caenorhabditis elegans GN=fgt-1 PE=1 SV=2 16 497 4.0E-34
sp|Q9SFG0|STP6_ARATH Sugar transport protein 6 OS=Arabidopsis thaliana GN=STP6 PE=1 SV=1 5 495 4.0E-34
sp|Q2V4B9|PLST3_ARATH Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2 14 485 6.0E-34
sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 72 491 1.0E-33
sp|Q9SBA7|STP8_ARATH Sugar transport protein 8 OS=Arabidopsis thaliana GN=STP8 PE=2 SV=2 5 492 3.0E-33
sp|Q9NY64|GTR8_HUMAN Solute carrier family 2, facilitated glucose transporter member 8 OS=Homo sapiens GN=SLC2A8 PE=1 SV=3 97 485 6.0E-33
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 77 499 1.0E-32
sp|Q9JIF3|GTR8_MOUSE Solute carrier family 2, facilitated glucose transporter member 8 OS=Mus musculus GN=Slc2a8 PE=1 SV=2 97 485 1.0E-32
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 7 492 2.0E-32
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 7 492 2.0E-32
sp|Q9FMX3|STP11_ARATH Sugar transport protein 11 OS=Arabidopsis thaliana GN=STP11 PE=1 SV=1 6 496 4.0E-32
sp|Q9SCW7|ERDL1_ARATH Sugar transporter ERD6-like 1 OS=Arabidopsis thaliana GN=SUGTL4 PE=2 SV=2 72 494 5.0E-32
sp|Q9JJZ1|GTR8_RAT Solute carrier family 2, facilitated glucose transporter member 8 OS=Rattus norvegicus GN=Slc2a8 PE=1 SV=1 97 485 6.0E-32
sp|Q9FYG3|PLST2_ARATH Probable plastidic glucose transporter 2 OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1 14 485 6.0E-32
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 14 491 7.0E-32
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 131 492 8.0E-32
sp|P79365|GTR1_SHEEP Solute carrier family 2, facilitated glucose transporter member 1 (Fragment) OS=Ovis aries GN=SLC2A1 PE=2 SV=1 131 497 9.0E-32
sp|P15729|GLCP_SYNY3 Glucose transport protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gtr PE=3 SV=2 10 485 2.0E-31
sp|O44616|FGTH1_CAEEL Facilitated glucose transporter homolog OS=Caenorhabditis elegans GN=R09B5.11 PE=1 SV=2 7 485 5.0E-31
sp|Q94KE0|ERDL3_ARATH Sugar transporter ERD6-like 3 OS=Arabidopsis thaliana GN=SUGTL2 PE=2 SV=1 72 489 5.0E-31
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 9 499 6.0E-31
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 5 495 8.0E-31
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 67 498 8.0E-31
sp|Q9LTP6|EDL13_ARATH Putative sugar transporter ERD6-like 13 OS=Arabidopsis thaliana GN=At3g20460 PE=3 SV=2 65 491 1.0E-30
sp|Q39228|STP4_ARATH Sugar transport protein 4 OS=Arabidopsis thaliana GN=STP4 PE=1 SV=1 79 492 2.0E-30
sp|P15686|HUP1_PARKE H(+)/hexose cotransporter 1 OS=Parachlorella kessleri GN=HUP1 PE=2 SV=2 6 484 2.0E-30
sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens GN=SLC2A7 PE=2 SV=2 3 497 5.0E-30
sp|Q8GW61|STP14_ARATH Sugar transport protein 14 OS=Arabidopsis thaliana GN=STP14 PE=2 SV=2 6 497 6.0E-30
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 3 489 1.0E-29
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 3 489 1.0E-29
sp|Q39524|HUP2_PARKE H(+)/hexose cotransporter 2 OS=Parachlorella kessleri GN=HUP2 PE=2 SV=1 9 484 1.0E-29
sp|Q93Y91|STP5_ARATH Sugar transport protein 5 OS=Arabidopsis thaliana GN=STP5 PE=2 SV=1 66 495 2.0E-29
sp|Q10710|STA_RICCO Sugar carrier protein A OS=Ricinus communis GN=STA PE=2 SV=1 52 495 2.0E-29
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 74 497 3.0E-29
sp|Q39525|HUP3_PARKE H(+)/hexose cotransporter 3 OS=Parachlorella kessleri GN=HUP3 PE=2 SV=1 6 484 3.0E-29
sp|A4ZYQ5|GTR7_RAT Solute carrier family 2, facilitated glucose transporter member 7 OS=Rattus norvegicus GN=Slc2a7 PE=2 SV=1 3 497 3.0E-29
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 61 491 4.0E-29
sp|P42833|HXT14_YEAST Hexose transporter HXT14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT14 PE=1 SV=2 11 489 5.0E-29
sp|Q9LNV3|STP2_ARATH Sugar transport protein 2 OS=Arabidopsis thaliana GN=STP2 PE=1 SV=3 5 443 6.0E-29
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 70 492 1.0E-28
sp|Q9UGQ3|GTR6_HUMAN Solute carrier family 2, facilitated glucose transporter member 6 OS=Homo sapiens GN=SLC2A6 PE=1 SV=2 79 498 2.0E-28
sp|Q9M0Z9|EDL15_ARATH Sugar transporter ERD6-like 15 OS=Arabidopsis thaliana GN=At4g04760 PE=3 SV=2 67 498 1.0E-27
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 60 491 2.0E-27
sp|P21906|GLF_ZYMMO Glucose facilitated diffusion protein OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glf PE=3 SV=2 88 492 2.0E-27
sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=2 24 485 5.0E-27
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 6 492 1.0E-26
sp|Q7XA64|ERDL9_ARATH Sugar transporter ERD6-like 9 OS=Arabidopsis thaliana GN=At3g05155 PE=2 SV=1 74 365 2.0E-26
sp|Q5RB09|GTR9_PONAB Solute carrier family 2, facilitated glucose transporter member 9 OS=Pongo abelii GN=SLC2A9 PE=2 SV=1 24 485 4.0E-26
sp|Q9WV38|GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus GN=Slc2a5 PE=1 SV=2 22 489 4.0E-26
sp|P43427|GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus GN=Slc2a5 PE=1 SV=1 7 497 9.0E-26
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 13 499 1.0E-25
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 79 484 3.0E-25
sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR387C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR387C PE=1 SV=1 57 494 6.0E-25
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 77 378 7.0E-25
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 79 484 1.0E-24
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 96 385 1.0E-24
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 85 387 1.0E-24
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 75 499 3.0E-24
sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 SV=1 79 484 4.0E-24
sp|Q0WWW9|XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2 84 484 5.0E-24
sp|Q5RET7|GTR5_PONAB Solute carrier family 2, facilitated glucose transporter member 5 OS=Pongo abelii GN=SLC2A5 PE=2 SV=1 22 497 7.0E-24
sp|Q8L7R8|STP3_ARATH Sugar transport protein 3 OS=Arabidopsis thaliana GN=STP3 PE=2 SV=2 1 483 1.0E-23
sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF3 PE=1 SV=3 79 492 3.0E-23
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 77 492 5.0E-23
sp|P53403|GTR3_DROME Glucose transporter type 3 OS=Drosophila melanogaster GN=Glut3 PE=2 SV=1 70 483 5.0E-23
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 79 484 7.0E-23
sp|Q863Y9|GTR5_HORSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Equus caballus GN=SLC2A5 PE=2 SV=1 13 497 8.0E-23
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 79 484 9.0E-23
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 96 492 1.0E-22
sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1 77 492 1.0E-22
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 75 483 2.0E-22
sp|Q6AWX0|XYLL2_ARATH D-xylose-proton symporter-like 2 OS=Arabidopsis thaliana GN=At5g17010 PE=1 SV=1 84 484 3.0E-22
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 100 387 4.0E-22
sp|Q4U3U6|QAY_NEUAF Quinate permease OS=Neurospora africana GN=qa-y PE=3 SV=1 75 483 6.0E-22
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 80 455 7.0E-22
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 77 484 8.0E-22
sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1 77 492 9.0E-22
sp|P15325|QUTD_EMENI Quinate permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutD PE=1 SV=2 75 484 1.0E-21
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 77 484 1.0E-21
sp|P11636|QAY_NEUCR Quinate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-y PE=3 SV=2 75 483 1.0E-21
sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 PE=1 SV=1 60 494 1.0E-21
sp|Q8L6Z8|XYLL1_ARATH D-xylose-proton symporter-like 1 OS=Arabidopsis thaliana GN=At3g03090 PE=2 SV=1 19 484 3.0E-21
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 77 492 3.0E-21
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 100 387 4.0E-21
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 77 492 9.0E-21
sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT3 PE=1 SV=1 77 484 9.0E-21
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 77 492 9.0E-21
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 96 383 1.0E-20
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 77 484 2.0E-20
sp|P22732|GTR5_HUMAN Solute carrier family 2, facilitated glucose transporter member 5 OS=Homo sapiens GN=SLC2A5 PE=1 SV=1 22 497 3.0E-20
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 77 484 5.0E-20
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 77 492 5.0E-20
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 78 494 1.0E-19
sp|Q9BYW1|GTR11_HUMAN Solute carrier family 2, facilitated glucose transporter member 11 OS=Homo sapiens GN=SLC2A11 PE=2 SV=1 10 485 1.0E-19
sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1 80 455 2.0E-19
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 77 484 1.0E-18
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 77 484 1.0E-18
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 77 492 1.0E-17
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 84 484 2.0E-17
sp|Q10286|ITR1_SCHPO Myo-inositol transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr1 PE=3 SV=1 77 443 2.0E-17
sp|P78831|GHT5_SCHPO High-affinity glucose transporter ght5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght5 PE=1 SV=2 77 492 2.0E-17
sp|A6ZT02|HXT4_YEAS7 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain YJM789) GN=HXT4 PE=3 SV=1 77 492 2.0E-17
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 83 246 2.0E-17
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 79 492 3.0E-17
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 94 489 3.0E-17
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 84 492 6.0E-17
sp|Q0D135|QUTD_ASPTN Probable quinate permease OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=qutD PE=3 SV=1 75 484 6.0E-17
sp|Q8TFG1|GHT7_SCHPO Probable high-affinity hexose transporter ght7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght7 PE=3 SV=1 77 491 1.0E-16
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 77 492 1.0E-16
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 83 246 2.0E-16
sp|P46408|GTR5_RABIT Solute carrier family 2, facilitated glucose transporter member 5 OS=Oryctolagus cuniculus GN=SLC2A5 PE=2 SV=1 4 499 2.0E-16
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 84 484 3.0E-16
sp|Q32NG5|GTR12_XENLA Solute carrier family 2, facilitated glucose transporter member 12 OS=Xenopus laevis GN=slc2a12 PE=2 SV=1 77 257 3.0E-16
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 94 484 3.0E-16
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 94 484 3.0E-16
sp|Q9P3U7|GHT8_SCHPO Probable high-affinity hexose transporter ght8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght8 PE=1 SV=1 77 492 5.0E-16
sp|Q6MYX6|QUTD_ASPFU Probable quinate permease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=qutD PE=3 SV=1 131 484 8.0E-16
sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT12 PE=5 SV=1 77 492 9.0E-16
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 70 246 2.0E-15
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 9 492 1.0E-14
sp|Q9P3U6|GHT1_SCHPO High-affinity glucose transporter ght1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght1 PE=1 SV=1 77 492 3.0E-14
sp|Q6GN01|GTR10_XENLA Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus laevis GN=slc2a10 PE=2 SV=1 75 364 4.0E-13
sp|A1CPX0|QUTD_ASPCL Probable quinate permease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=qutD PE=3 SV=1 131 484 5.0E-13
sp|Q0P4G6|GTR10_XENTR Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus tropicalis GN=slc2a10 PE=2 SV=1 75 364 5.0E-13
sp|A1D2R3|QUTD_NEOFI Probable quinate permease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=qutD PE=3 SV=1 75 484 8.0E-13
sp|Q8TD20|GTR12_HUMAN Solute carrier family 2, facilitated glucose transporter member 12 OS=Homo sapiens GN=SLC2A12 PE=2 SV=1 77 245 3.0E-12
sp|Q9XT10|GTR4_PIG Solute carrier family 2, facilitated glucose transporter member 4 (Fragment) OS=Sus scrofa GN=SLC2A4 PE=2 SV=1 4 169 5.0E-12
sp|Q9BE72|GTR12_MACFA Solute carrier family 2, facilitated glucose transporter member 12 OS=Macaca fascicularis GN=SLC2A12 PE=2 SV=1 77 245 7.0E-12
sp|Q1RPP5|S22A7_PIG Solute carrier family 22 member 7 OS=Sus scrofa GN=SLC22A7 PE=2 SV=1 61 233 1.0E-11
sp|Q95R48|OCTL_DROME Organic cation transporter-like protein OS=Drosophila melanogaster GN=Orct2 PE=2 SV=2 75 273 1.0E-11
sp|Q8BFW9|GTR12_MOUSE Solute carrier family 2, facilitated glucose transporter member 12 OS=Mus musculus GN=Slc2a12 PE=2 SV=1 77 235 1.0E-11
sp|Q9R0W2|S22A2_RAT Solute carrier family 22 member 2 OS=Rattus norvegicus GN=Slc22a2 PE=1 SV=1 78 238 2.0E-11
sp|Q5R540|S22A7_PONAB Solute carrier family 22 member 7 OS=Pongo abelii GN=SLC22A7 PE=2 SV=1 42 237 3.0E-11
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 289 484 4.0E-11
sp|Q9Y694|S22A7_HUMAN Solute carrier family 22 member 7 OS=Homo sapiens GN=SLC22A7 PE=1 SV=1 46 237 4.0E-11
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 295 484 5.0E-11
sp|O70577|S22A2_MOUSE Solute carrier family 22 member 2 OS=Mus musculus GN=Slc22a2 PE=1 SV=1 78 238 5.0E-11
sp|Q5J316|GTR12_BOVIN Solute carrier family 2, facilitated glucose transporter member 12 OS=Bos taurus GN=SLC2A12 PE=1 SV=1 77 245 7.0E-11
sp|Q3YAW7|S22A7_RABIT Solute carrier family 22 member 7 OS=Oryctolagus cuniculus GN=SLC22A7 PE=2 SV=1 78 233 2.0E-10
sp|B0XQS8|QUTD_ASPFC Probable quinate permease OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=qutD PE=3 SV=1 131 484 2.0E-10
sp|O15245|S22A1_HUMAN Solute carrier family 22 member 1 OS=Homo sapiens GN=SLC22A1 PE=1 SV=2 78 238 3.0E-10
sp|Q5RLM2|S22A7_RAT Solute carrier family 22 member 7 OS=Rattus norvegicus GN=Slc22a7 PE=1 SV=1 78 231 3.0E-10
sp|O95528|GTR10_HUMAN Solute carrier family 2, facilitated glucose transporter member 10 OS=Homo sapiens GN=SLC2A10 PE=1 SV=2 100 364 7.0E-10
sp|Q8MJI6|S22A2_RABIT Solute carrier family 22 member 2 OS=Oryctolagus cuniculus GN=SLC22A2 PE=1 SV=1 78 238 1.0E-09
sp|Q63089|S22A1_RAT Solute carrier family 22 member 1 OS=Rattus norvegicus GN=Slc22a1 PE=1 SV=1 78 238 2.0E-09
sp|O08966|S22A1_MOUSE Solute carrier family 22 member 1 OS=Mus musculus GN=Slc22a1 PE=1 SV=2 78 238 2.0E-09
sp|Q91WU2|S22A7_MOUSE Solute carrier family 22 member 7 OS=Mus musculus GN=Slc22a7 PE=1 SV=1 78 231 2.0E-09
sp|A6QLW8|S22A7_BOVIN Solute carrier family 22 member 7 OS=Bos taurus GN=SLC22A7 PE=2 SV=1 77 233 3.0E-09
sp|O15244|S22A2_HUMAN Solute carrier family 22 member 2 OS=Homo sapiens GN=SLC22A2 PE=1 SV=2 70 238 8.0E-09
sp|O77504|S22A1_RABIT Solute carrier family 22 member 1 OS=Oryctolagus cuniculus GN=SLC22A1 PE=1 SV=1 78 238 9.0E-09
sp|Q9XST2|GTR4_CANLF Solute carrier family 2, facilitated glucose transporter member 4 (Fragment) OS=Canis lupus familiaris GN=SLC2A4 PE=2 SV=1 333 483 2.0E-08
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 289 484 3.0E-08
sp|O62787|GTR3_PIG Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Sus scrofa GN=SLC2A3 PE=2 SV=1 132 221 3.0E-08
sp|O02713|S22A2_PIG Solute carrier family 22 member 2 OS=Sus scrofa GN=SLC22A2 PE=2 SV=1 70 238 4.0E-08
sp|Q5R5H7|S22A2_PONAB Solute carrier family 22 member 2 OS=Pongo abelii GN=SLC22A2 PE=2 SV=1 82 238 5.0E-08
sp|Q27115|HT1_TRYVI Glucose transporter HT1 OS=Trypanosoma vivax GN=HT1 PE=3 SV=1 83 181 9.0E-08
sp|Q8VHD6|GTR10_MOUSE Solute carrier family 2, facilitated glucose transporter member 10 OS=Mus musculus GN=Slc2a10 PE=2 SV=1 100 419 1.0E-07
sp|Q9VCA2|ORCT_DROME Organic cation transporter protein OS=Drosophila melanogaster GN=Orct PE=1 SV=1 75 222 1.0E-07
sp|Q6NUB3|S22AF_XENLA Solute carrier family 22 member 15 OS=Xenopus laevis GN=slc22a15 PE=2 SV=2 78 237 3.0E-07
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 84 243 3.0E-07
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 59 235 4.0E-07
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 395 491 5.0E-07
sp|Q7ZX53|S22FL_XENLA Solute carrier family 22 member 15-like OS=Xenopus laevis GN=slc22a15b PE=2 SV=1 78 234 5.0E-07
sp|O95528|GTR10_HUMAN Solute carrier family 2, facilitated glucose transporter member 10 OS=Homo sapiens GN=SLC2A10 PE=1 SV=2 391 496 1.0E-06
sp|P13865|PRO1_LEIEN Probable transport protein OS=Leishmania enriettii GN=PRO-1 PE=2 SV=1 38 499 1.0E-06
sp|Q8VHD6|GTR10_MOUSE Solute carrier family 2, facilitated glucose transporter member 10 OS=Mus musculus GN=Slc2a10 PE=2 SV=1 391 498 2.0E-06
sp|Q28ES4|S22FL_XENTR Solute carrier family 22 member 15-like OS=Xenopus tropicalis GN=slc22a15b PE=2 SV=1 30 234 2.0E-06
sp|O62786|GTR2_PIG Solute carrier family 2, facilitated glucose transporter member 2 (Fragment) OS=Sus scrofa GN=SLC2A2 PE=2 SV=1 388 491 2.0E-06
sp|Q8IZD6|S22AF_HUMAN Solute carrier family 22 member 15 OS=Homo sapiens GN=SLC22A15 PE=2 SV=1 46 238 3.0E-06
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 393 491 5.0E-06
sp|Q6DFR1|S22AF_XENTR Solute carrier family 22 member 15 OS=Xenopus tropicalis GN=slc22a15 PE=2 SV=2 78 231 5.0E-06
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 393 491 6.0E-06
sp|A7MBE0|S22A1_BOVIN Solute carrier family 22 member 1 OS=Bos taurus GN=SLC22A1 PE=2 SV=1 78 238 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 73 95 22
3 108 130 22
4 134 153 19
5 160 182 22
6 192 211 19
7 297 319 22
8 329 351 22
9 363 385 22
10 389 411 22
11 423 445 22
12 455 477 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5077
MAGRSITAHLLLVIAIATLGPLQFGFHLAELNAPQDVITCRKKSVSTVTARQSAWLLRPSDLPSACIPMNEATFA
TVSSIFTLGALVGALASGPFSSRRGRRLTMRITAVLYLVGSLVESAAANAATMSFGRFFSGLGAGASTVVVPLYV
SEISHPSERGLFGAMTQISINVGILGTQALGYFLSHGRDWRWILGAGAIIAAIQAIGLFCVPESPIWLAANGDVA
TARRTMQRIRGKSFDIHQEVASWSYHDGSEHEGLLPAADGSAPPSPPPQPASQPPVHLGFTQVVRDTRYRPAIVA
LVGVMIAQQICGINAVIMYSVSLFADVFPTSSALLTIIISTVNLIMTAACAPLPDRLGRKTCLLLSTVGQGTSAL
LLALSIVFGVKLLSAIVVLFFVAFFAVGLGPVPFILASELVSQEAVGAAQSWCLAANYIGTFFVAQFFPVINTAL
NKALGGSGWAFFLFAALAAGSVLFVYVKVPETRGKKDMDEVWGRYRRSD
Coding >Ophio5|5077
ATGGCTGGCCGCAGCATCACGGCCCATCTCTTGCTAGTCATCGCCATCGCGACACTTGGACCGCTGCAGTTTGGC
TTCCACCTCGCCGAGCTCAACGCACCGCAAGATGTCATTACCTGTCGCAAAAAATCCGTTTCGACTGTCACCGCG
CGACAGTCGGCATGGCTGCTGCGCCCGTCCGACCTCCCATCGGCCTGTATCCCGATGAACGAGGCAACCTTTGCC
ACCGTTTCTTCGATATTCACTCTCGGCGCTCTCGTCGGCGCCCTGGCCTCCGGACCCTTCTCCTCAAGACGCGGC
CGCCGGCTGACGATGCGCATCACCGCTGTTCTGTACCTCGTCGGCTCTCTGGTCGAGTCAGCCGCAGCCAACGCT
GCCACCATGTCGTTTGGTCGCTTCTTTTCAGGCCTCGGAGCCGGTGCCTCGACTGTCGTTGTGCCGCTCTACGTC
AGCGAAATATCTCACCCGTCTGAGAGGGGCCTGTTTGGGGCCATGACCCAGATATCCATCAACGTGGGCATCCTC
GGCACACAGGCGCTTGGCTACTTCTTGAGTCATGGCCGTGACTGGCGCTGGATCTTGGGCGCCGGAGCCATCATT
GCTGCCATCCAGGCCATCGGGCTTTTTTGTGTCCCGGAGAGTCCGATCTGGCTTGCTGCCAACGGTGACGTGGCT
ACGGCCAGGCGGACGATGCAGCGCATTCGGGGCAAGAGCTTTGACATTCACCAAGAGGTGGCGTCCTGGAGCTAT
CATGATGGCTCGGAGCACGAGGGCCTGCTGCCTGCAGCAGACGGATCGGCGCCGCCGTCGCCGCCCCCTCAGCCG
GCGTCCCAGCCGCCCGTTCATCTCGGATTCACGCAGGTGGTCAGGGATACACGATACCGGCCCGCCATCGTGGCG
CTTGTCGGTGTCATGATCGCGCAGCAGATCTGCGGCATTAACGCCGTGATAATGTATTCCGTCTCCCTCTTCGCC
GATGTTTTCCCCACCTCGTCAGCTCTCCTGACCATCATCATCTCGACTGTCAATCTCATCATGACGGCCGCCTGC
GCACCGCTGCCCGATCGCCTCGGCCGCAAGACCTGTCTACTTCTGTCGACCGTCGGCCAGGGTACCAGCGCTCTG
CTACTCGCTCTGTCCATTGTGTTTGGTGTGAAGCTGCTGTCAGCAATAGTCGTTTTGTTCTTCGTTGCCTTCTTC
GCTGTCGGGCTTGGTCCGGTGCCGTTTATTCTGGCATCGGAGCTCGTCAGCCAGGAGGCTGTGGGAGCGGCCCAG
AGCTGGTGTCTGGCGGCCAATTATATCGGCACCTTTTTCGTCGCCCAATTCTTCCCCGTCATCAACACGGCGCTC
AATAAGGCTCTTGGGGGCTCGGGCTGGGCTTTCTTTTTGTTTGCCGCGCTGGCTGCGGGGTCAGTCCTGTTTGTG
TATGTCAAGGTGCCCGAAACGCGAGGCAAGAAGGACATGGATGAGGTTTGGGGGCGGTATCGTCGATCGGAT
Transcript >Ophio5|5077
ATGGCTGGCCGCAGCATCACGGCCCATCTCTTGCTAGTCATCGCCATCGCGACACTTGGACCGCTGCAGTTTGGC
TTCCACCTCGCCGAGCTCAACGCACCGCAAGATGTCATTACCTGTCGCAAAAAATCCGTTTCGACTGTCACCGCG
CGACAGTCGGCATGGCTGCTGCGCCCGTCCGACCTCCCATCGGCCTGTATCCCGATGAACGAGGCAACCTTTGCC
ACCGTTTCTTCGATATTCACTCTCGGCGCTCTCGTCGGCGCCCTGGCCTCCGGACCCTTCTCCTCAAGACGCGGC
CGCCGGCTGACGATGCGCATCACCGCTGTTCTGTACCTCGTCGGCTCTCTGGTCGAGTCAGCCGCAGCCAACGCT
GCCACCATGTCGTTTGGTCGCTTCTTTTCAGGCCTCGGAGCCGGTGCCTCGACTGTCGTTGTGCCGCTCTACGTC
AGCGAAATATCTCACCCGTCTGAGAGGGGCCTGTTTGGGGCCATGACCCAGATATCCATCAACGTGGGCATCCTC
GGCACACAGGCGCTTGGCTACTTCTTGAGTCATGGCCGTGACTGGCGCTGGATCTTGGGCGCCGGAGCCATCATT
GCTGCCATCCAGGCCATCGGGCTTTTTTGTGTCCCGGAGAGTCCGATCTGGCTTGCTGCCAACGGTGACGTGGCT
ACGGCCAGGCGGACGATGCAGCGCATTCGGGGCAAGAGCTTTGACATTCACCAAGAGGTGGCGTCCTGGAGCTAT
CATGATGGCTCGGAGCACGAGGGCCTGCTGCCTGCAGCAGACGGATCGGCGCCGCCGTCGCCGCCCCCTCAGCCG
GCGTCCCAGCCGCCCGTTCATCTCGGATTCACGCAGGTGGTCAGGGATACACGATACCGGCCCGCCATCGTGGCG
CTTGTCGGTGTCATGATCGCGCAGCAGATCTGCGGCATTAACGCCGTGATAATGTATTCCGTCTCCCTCTTCGCC
GATGTTTTCCCCACCTCGTCAGCTCTCCTGACCATCATCATCTCGACTGTCAATCTCATCATGACGGCCGCCTGC
GCACCGCTGCCCGATCGCCTCGGCCGCAAGACCTGTCTACTTCTGTCGACCGTCGGCCAGGGTACCAGCGCTCTG
CTACTCGCTCTGTCCATTGTGTTTGGTGTGAAGCTGCTGTCAGCAATAGTCGTTTTGTTCTTCGTTGCCTTCTTC
GCTGTCGGGCTTGGTCCGGTGCCGTTTATTCTGGCATCGGAGCTCGTCAGCCAGGAGGCTGTGGGAGCGGCCCAG
AGCTGGTGTCTGGCGGCCAATTATATCGGCACCTTTTTCGTCGCCCAATTCTTCCCCGTCATCAACACGGCGCTC
AATAAGGCTCTTGGGGGCTCGGGCTGGGCTTTCTTTTTGTTTGCCGCGCTGGCTGCGGGGTCAGTCCTGTTTGTG
TATGTCAAGGTGCCCGAAACGCGAGGCAAGAAGGACATGGATGAGGTTTGGGGGCGGTATCGTCGATCGGATTAG
Gene >Ophio5|5077
ATGGCTGGCCGCAGCATCACGGCCCATCTCTTGCTAGTCATCGCCATCGCGACACTTGGACCGCTGCAGTTTGGC
TTCCACCTCGTGAGTGGCGCCCGCCTACTTGTCAAACACGGTCATCATCGCCATGCTAACCTTGGTTTGTTCGTC
CAGGCCGAGCTCAACGCACCGCAAGATGTCATTACCTGTCGCAAAAAATCCGTTTCGACTGTCACCGCGCGACAG
TCGGCATGGCTGCTGCGCCCGTCCGACCTCCCATCGGCCTGTATCCCGATGAACGAGGCAACCTTTGCCACCGTT
TCTTCGATATTCACTCTCGGCGCTCTCGTCGGCGCCCTGGCCTCCGGACCCTTCTCCTCAAGACGCGGCCGCCGG
CTGACGATGCGCATCACCGCTGTTCTGTACCTCGTCGGCTCTCTGGTCGAGTCAGCCGCAGCCAACGCTGCCACC
ATGTCGTTTGGTCGCTTCTTTTCAGGCCTCGGAGCCGGTGCCTCGACTGTCGTTGTGCCGCTCTACGTCAGCGAA
ATATCTCACCCGTCTGAGAGGGGCCTGTTTGGGGCCATGACCCAGATATCCATCAACGTGGGCATCCTCGGCACA
CAGGCGCTTGGCTACTTCTTGAGTCATGGCCGTGACTGGCGCTGGATCTTGGGCGCCGGAGCCATCATTGCTGCC
ATCCAGGCCATCGGGCTTTTTTGTGTCCCGGAGAGTCCGATCTGGCTTGCTGCCAACGGTGACGTGGCTACGGCC
AGGCGGACGATGCAGCGCATTCGGGGCAAGAGCTTTGACATTCACCAAGAGGTGGCGTCCTGGAGCTATCATGAT
GGCTCGGAGCACGAGGGCCTGCTGCCTGCAGCAGACGGATCGGCGCCGCCGTCGCCGCCCCCTCAGCCGGCGTCC
CAGCCGCCCGTTCATCTCGGATTCACGCAGGTGGTCAGGGATACACGATACCGGCCCGCCATCGTGGCGCTTGTC
GGTGTCATGATCGCGCAGCAGATCTGCGGCATTAACGCCGTGATAATGTATTCCGTCTCCCTCTTCGCCGATGTT
TTCCCCACCTCGTCAGCTCTCCTGACCATCATCATCTCGACTGTCAATCTCATCATGACGGCCGCCTGCGCACCG
CTGCCCGATCGCCTCGGCCGCAAGACCTGTCTACTTCTGTCGACCGTCGGCCAGGGTACCAGCGCTCTGCTACTC
GCTCTGTCCATTGTGTTTGGTGTGAAGCTGCTGTCAGCAATAGTCGTTTTGTTCTTCGTTGCCTTCTTCGCTGTC
GGGCTTGGTCCGGTGCCGTTTATTCTGGCATCGGAGCTCGTCAGCCAGGAGGCTGTGGGAGCGGCCCAGAGCTGG
TGTCTGGCGGCCAATTATATCGGCACCTTTTTCGTCGCCCAATTCTTCCCCGTCATCAACACGGCGCTCAATAAG
GCTCTTGGGGGCTCGGGCTGGGCTTTCTTTTTGTTTGCCGCGCTGGCTGCGGGGTCAGTCCTGTTTGTGTATGTC
AAGGTGCCCGAAACGCGAGGCAAGAAGGACATGGATGAGGTTTGGGGGCGGTATCGTCGATCGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail