Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5068
Gene name
Locationscaffold_407:12602..12982
Strand+
Gene length (bp)380
Transcript length (bp)330
Coding sequence length (bp)327
Protein length (aa) 109

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05768 Glrx-like Glutaredoxin-like domain (DUF836) 8.8E-12 12 99

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9CWB7|YD286_MOUSE Glutaredoxin-like protein C5orf63 homolog OS=Mus musculus PE=1 SV=1 13 104 3.0E-09
sp|Q05530|YD286_YEAST Glutaredoxin-like protein YDR286C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR286C PE=3 SV=1 1 105 6.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5068
MFASRRLLQACRITFFTRENCGLCAEAGATLSNVANNRPFVYVKVDLARPESRLWRELYDFDIPVIHISRASAEP
EEVATASKAVKLMHRFTSAQIEAKMDQVEAAKDQ
Coding >Ophio5|5068
ATGTTCGCATCAAGGCGTCTCCTTCAGGCCTGCAGAATCACCTTCTTCACCCGCGAGAATTGCGGACTCTGCGCC
GAGGCTGGAGCCACGCTGTCGAATGTGGCCAACAACAGGCCGTTCGTCTACGTCAAGGTGGACCTGGCACGACCA
GAGTCCCGGCTATGGCGGGAGCTGTACGACTTTGATATCCCCGTTATTCATATCAGTAGGGCCTCCGCCGAGCCA
GAGGAGGTGGCTACCGCCAGCAAGGCCGTCAAATTGATGCACCGTTTCACATCTGCCCAGATCGAGGCTAAGATG
GACCAGGTCGAGGCAGCTAAAGACCAA
Transcript >Ophio5|5068
ATGTTCGCATCAAGGCGTCTCCTTCAGGCCTGCAGAATCACCTTCTTCACCCGCGAGAATTGCGGACTCTGCGCC
GAGGCTGGAGCCACGCTGTCGAATGTGGCCAACAACAGGCCGTTCGTCTACGTCAAGGTGGACCTGGCACGACCA
GAGTCCCGGCTATGGCGGGAGCTGTACGACTTTGATATCCCCGTTATTCATATCAGTAGGGCCTCCGCCGAGCCA
GAGGAGGTGGCTACCGCCAGCAAGGCCGTCAAATTGATGCACCGTTTCACATCTGCCCAGATCGAGGCTAAGATG
GACCAGGTCGAGGCAGCTAAAGACCAATAA
Gene >Ophio5|5068
ATGTTCGCATCAAGGCGTCTCCTTCAGGCCTGCAGAATCACCTTCTTCACCCGCGAGAATTGCGGACTCTGCGCC
GAGGCTGGAGCCACGCTGTCGAATGTGGCCAACAACAGGCCGTTCGTCTACGTCAAGGTGGACCTGGCACGACCA
GAGTCCCGGCTATGGCGGGAGCTGTACGACTTTGATATCCCCGTTGTGAGTGCCTTTGGTCACACGGGCGATCAG
TCGATTTGACTACTGGACAGATTCATATCAGTAGGGCCTCCGCCGAGCCAGAGGAGGTGGCTACCGCCAGCAAGG
CCGTCAAATTGATGCACCGTTTCACATCTGCCCAGATCGAGGCTAAGATGGACCAGGTCGAGGCAGCTAAAGACC
AATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail