Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5067
Gene name
Locationscaffold_407:10873..12205
Strand-
Gene length (bp)1332
Transcript length (bp)990
Coding sequence length (bp)987
Protein length (aa) 329

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04968 CHORD CHORD 1.5E-23 4 61
PF04968 CHORD CHORD 3.0E-26 128 188
PF04969 CS CS domain 3.0E-11 209 287

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VCC0|CHRD1_DROME Cysteine and histidine-rich domain-containing protein OS=Drosophila melanogaster GN=CHORD PE=1 SV=1 3 297 1.0E-45
sp|Q9UHD1|CHRD1_HUMAN Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens GN=CHORDC1 PE=1 SV=2 1 296 2.0E-43
sp|D4A4T9|CHRD1_RAT Cysteine and histidine-rich domain-containing protein 1 OS=Rattus norvegicus GN=Chordc1 PE=3 SV=1 1 296 2.0E-43
sp|Q9D1P4|CHRD1_MOUSE Cysteine and histidine-rich domain-containing protein 1 OS=Mus musculus GN=Chordc1 PE=1 SV=1 1 296 3.0E-43
sp|Q6NUA0|CHRD1_XENLA Cysteine and histidine-rich domain-containing protein 1 OS=Xenopus laevis GN=chordc1 PE=2 SV=1 1 297 4.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VCC0|CHRD1_DROME Cysteine and histidine-rich domain-containing protein OS=Drosophila melanogaster GN=CHORD PE=1 SV=1 3 297 1.0E-45
sp|Q9UHD1|CHRD1_HUMAN Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens GN=CHORDC1 PE=1 SV=2 1 296 2.0E-43
sp|D4A4T9|CHRD1_RAT Cysteine and histidine-rich domain-containing protein 1 OS=Rattus norvegicus GN=Chordc1 PE=3 SV=1 1 296 2.0E-43
sp|Q9D1P4|CHRD1_MOUSE Cysteine and histidine-rich domain-containing protein 1 OS=Mus musculus GN=Chordc1 PE=1 SV=1 1 296 3.0E-43
sp|Q6NUA0|CHRD1_XENLA Cysteine and histidine-rich domain-containing protein 1 OS=Xenopus laevis GN=chordc1 PE=2 SV=1 1 297 4.0E-43
sp|Q29RL2|CHRD1_BOVIN Cysteine and histidine-rich domain-containing protein 1 OS=Bos taurus GN=CHORDC1 PE=2 SV=1 1 296 4.0E-43
sp|A9YUB1|CHRD1_PIG Cysteine and histidine-rich domain-containing protein 1 OS=Sus scrofa GN=CHORDC1 PE=2 SV=1 1 296 1.0E-42
sp|Q5RD91|CHRD1_PONAB Cysteine and histidine-rich domain-containing protein 1 OS=Pongo abelii GN=CHORDC1 PE=2 SV=1 1 296 2.0E-42
sp|Q7T3F7|CHRD1_DANRE Cysteine and histidine-rich domain-containing protein 1 OS=Danio rerio GN=chordc1 PE=2 SV=1 1 296 2.0E-42
sp|Q4R7U2|CHRD1_MACFA Cysteine and histidine-rich domain-containing protein 1 OS=Macaca fascicularis GN=CHORDC1 PE=2 SV=1 1 296 3.0E-42
sp|Q5ZML4|CHRD1_CHICK Cysteine and histidine-rich domain-containing protein 1 OS=Gallus gallus GN=CHORDC1 PE=2 SV=1 1 296 7.0E-41
sp|Q462R2|ITBP2_PIG Integrin beta-1-binding protein 2 OS=Sus scrofa GN=ITGB1BP2 PE=2 SV=1 1 297 2.0E-39
sp|Q9R000|ITBP2_MOUSE Integrin beta-1-binding protein 2 OS=Mus musculus GN=Itgb1bp2 PE=1 SV=1 1 297 4.0E-38
sp|Q9UKP3|ITBP2_HUMAN Integrin beta-1-binding protein 2 OS=Homo sapiens GN=ITGB1BP2 PE=1 SV=1 1 296 2.0E-36
sp|Q9SE33|RAR1_ARATH Cysteine and histidine-rich domain-containing protein RAR1 OS=Arabidopsis thaliana GN=RAR1 PE=1 SV=1 4 190 1.0E-23
sp|Q6EPW7|RAR1_ORYSJ Cysteine and histidine-rich domain-containing protein RAR1 OS=Oryza sativa subsp. japonica GN=RAR1 PE=1 SV=2 4 190 1.0E-22
sp|Q9SE33|RAR1_ARATH Cysteine and histidine-rich domain-containing protein RAR1 OS=Arabidopsis thaliana GN=RAR1 PE=1 SV=1 3 68 2.0E-14
sp|Q6EPW7|RAR1_ORYSJ Cysteine and histidine-rich domain-containing protein RAR1 OS=Oryza sativa subsp. japonica GN=RAR1 PE=1 SV=2 5 62 1.0E-12
sp|Q9CX34|SGT1_MOUSE Protein SGT1 homolog OS=Mus musculus GN=Sugt1 PE=1 SV=3 175 296 5.0E-07
sp|Q2KIK0|SGT1_BOVIN Protein SGT1 homolog OS=Bos taurus GN=SUGT1 PE=2 SV=1 209 296 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5067
MAQKCVRQGCGKQFSDPKEDCHYHPGPPVFHEGQKGWKCCKPRVLTFDEFMTIPPCTTGTHSTTDKPAQLDEGPQ
DDGAALAKKIEALTASAPPRVPIPSSQRTATPPPPPPETDDDDPSLDIPDGAECRRKGCGQRYSKGGSRESEQCL
HHPGAPIFHEGSKGYSCCKRRVLEFDQFLKIEGCKTKSNHLFIGSGSKKKSGPEKLDSVRHDFYQTPTTVIASFF
LKKIEKGTSKVVFEARKLSLDLTTSDSPPKRYAADVPLFGPIDTDASTHKILGTKLELTLVKADGASWPVLRKAW
SDGFKDLEVKLGGVALKVGRRQPPDQRIR
Coding >Ophio5|5067
ATGGCGCAGAAATGTGTGCGTCAGGGCTGCGGCAAGCAGTTCAGCGACCCAAAGGAAGACTGCCACTATCATCCT
GGCCCGCCCGTCTTCCACGAGGGGCAGAAAGGATGGAAGTGCTGCAAGCCGCGCGTCTTGACCTTTGACGAATTC
ATGACCATCCCGCCCTGCACGACCGGCACGCATTCGACAACCGACAAGCCCGCTCAACTCGACGAAGGACCGCAG
GACGACGGCGCGGCCCTGGCCAAGAAGATTGAGGCCTTGACGGCTTCTGCTCCGCCGCGGGTGCCTATACCATCC
TCACAGCGGACGGCTACGCCGCCACCGCCGCCACCGGAGACGGACGACGATGACCCGAGCTTGGACATTCCCGAC
GGTGCCGAGTGCCGGCGGAAAGGATGCGGACAGAGATACAGCAAGGGGGGCTCGCGAGAGTCAGAGCAGTGTCTT
CACCATCCTGGCGCTCCCATTTTCCACGAGGGTAGCAAGGGATACTCGTGCTGCAAGCGGCGCGTCCTGGAGTTC
GACCAGTTTCTGAAGATCGAGGGCTGCAAGACCAAGAGCAATCATCTCTTCATCGGTAGCGGCAGCAAGAAAAAG
TCTGGTCCGGAGAAGCTAGACTCTGTCAGACACGACTTTTATCAGACGCCGACGACCGTCATCGCCTCATTCTTC
CTTAAGAAGATTGAAAAAGGCACATCCAAGGTGGTATTCGAGGCCCGGAAGCTCTCGCTCGACCTGACGACGAGT
GACTCGCCGCCGAAGCGGTACGCCGCCGACGTACCGCTCTTTGGCCCCATTGATACGGATGCGTCGACACATAAG
ATCCTGGGGACGAAGCTGGAGCTGACGCTTGTCAAGGCAGACGGAGCGTCGTGGCCGGTCCTGCGGAAGGCATGG
TCAGACGGTTTTAAAGATTTGGAAGTGAAGTTGGGAGGTGTTGCCTTGAAAGTTGGGAGACGTCAACCTCCAGAC
CAGCGAATTAGA
Transcript >Ophio5|5067
ATGGCGCAGAAATGTGTGCGTCAGGGCTGCGGCAAGCAGTTCAGCGACCCAAAGGAAGACTGCCACTATCATCCT
GGCCCGCCCGTCTTCCACGAGGGGCAGAAAGGATGGAAGTGCTGCAAGCCGCGCGTCTTGACCTTTGACGAATTC
ATGACCATCCCGCCCTGCACGACCGGCACGCATTCGACAACCGACAAGCCCGCTCAACTCGACGAAGGACCGCAG
GACGACGGCGCGGCCCTGGCCAAGAAGATTGAGGCCTTGACGGCTTCTGCTCCGCCGCGGGTGCCTATACCATCC
TCACAGCGGACGGCTACGCCGCCACCGCCGCCACCGGAGACGGACGACGATGACCCGAGCTTGGACATTCCCGAC
GGTGCCGAGTGCCGGCGGAAAGGATGCGGACAGAGATACAGCAAGGGGGGCTCGCGAGAGTCAGAGCAGTGTCTT
CACCATCCTGGCGCTCCCATTTTCCACGAGGGTAGCAAGGGATACTCGTGCTGCAAGCGGCGCGTCCTGGAGTTC
GACCAGTTTCTGAAGATCGAGGGCTGCAAGACCAAGAGCAATCATCTCTTCATCGGTAGCGGCAGCAAGAAAAAG
TCTGGTCCGGAGAAGCTAGACTCTGTCAGACACGACTTTTATCAGACGCCGACGACCGTCATCGCCTCATTCTTC
CTTAAGAAGATTGAAAAAGGCACATCCAAGGTGGTATTCGAGGCCCGGAAGCTCTCGCTCGACCTGACGACGAGT
GACTCGCCGCCGAAGCGGTACGCCGCCGACGTACCGCTCTTTGGCCCCATTGATACGGATGCGTCGACACATAAG
ATCCTGGGGACGAAGCTGGAGCTGACGCTTGTCAAGGCAGACGGAGCGTCGTGGCCGGTCCTGCGGAAGGCATGG
TCAGACGGTTTTAAAGATTTGGAAGTGAAGTTGGGAGGTGTTGCCTTGAAAGTTGGGAGACGTCAACCTCCAGAC
CAGCGAATTAGATGA
Gene >Ophio5|5067
ATGGCGCAGAAATGTGTGCGTCAGGGCTGCGGCAAGCAGTTCAGCGACCCAAAGGAAGACTGCCACTATCATCCT
GGCCCGCCCGTCTTCCACGAGGGGCAGAAAGGTAAGCAGATAGGCAACCGCGAGCCTTTCTTTCCAGCCGACACT
GAGACACACACTGAGCCGCGCCAGGATGGAAGTGCTGCAAGCCGCGCGTCTTGACCTTTGACGAATTCATGACCA
TCCCGCCCTGCACGACCGGCACGCATTCGACAACCGACAAGCCCGCTCAACTCGACGAAGGACCGCAGGACGACG
GCGCGGCCCTGGCCAAGAAGATTGAGGCCTTGACGGCTTCTGCTCCGCCGCGGGTGCCTATACCATCCTCACAGC
GGACGGCTACGCCGCCACCGCCGCCACCGGAGACGGACGACGATGACCCGAGCTTGGACATTCCCGACGGTGCCG
AGTGCCGGCGGAAAGGATGCGGACAGAGATACAGCAAGGGGGGCTCGCGAGAGTCAGAGCAGTGTCTTCACCATC
CTGGCGCTCCCATTTTCCACGAGGGTAGCAAGGGATACTCGTGCTGCAAGCGGCGCGTCCTGGAGTTCGACCAGT
TTCTGAAGATCGAGGGCTGCAAGACCAAGAGCAATCATCTCTTCATCGGTAGCGGCAGCAAGAAAAAGTCTGGTC
CGGAGAAGCTAGACTCTGTCAGGTGAGCACCCTCTGTTTTTATCTGGGCCGCGAAGACTGCGACTGAGAAGATCT
GCAGACACGACTTTTATCAGACGCCGACGACCGTCATCGCCTCATTCTTCCTTAAGAAGATTGAAAAAGGCACAT
CCAAGGTGGTATTCGAGGCCCGGAAGCTCTCGCTCGACCTGACGACGAGTGACTCGCCGCCGAAGCGGTACGCCG
CCGACGTACCGCTCTTTGGCCCCATTGATACGGATGCGTCGACACATAAGATCCTGGGGACGAAGCTGGAGCTGA
CGCTTGTCAAGGCAGACGGAGCGTCGTGGCCGGTCCTGCGGAGTGACGAGGCATTAACGGGCGAGATTTTGCAAG
TTGGAAAGGCTGGACGAGCATAGAGGCATGGTCAGACGGTTTTAAAGAGTATACAACCTTGACTCAGCGTCCAGA
CATGAACGCTAACAGACAGTACGACAAGTTTGGAAGTGAAGTTGGGAGGGTGAGACGGAGACACAAGAGCGTGAG
CCGTCAACGGCCAAACTTCCGGTCCTTAACATAGTGTTGCCTTGAAAGTTGGGAGACGTCAACCTCCAGACCAGC
GAATTAGGTGCGTACCAAAGGAAATAGAAGGCTTGACATGACAGTTGGTGCAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail