Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5064
Gene name
Locationscaffold_407:6022..8047
Strand-
Gene length (bp)2025
Transcript length (bp)1968
Coding sequence length (bp)1965
Protein length (aa) 655

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11700 ATG22 Vacuole effluxer Atg22 like 1.3E-196 74 608

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SG38|ATG22_NEUCR Autophagy-related protein 22 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-11 PE=3 SV=1 21 645 0.0E+00
sp|Q2UD74|AT222_ASPOR Autophagy-related protein 22-2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg22-2 PE=3 SV=2 64 616 0.0E+00
sp|Q4WZY1|AT222_ASPFU Autophagy-related protein 22-2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg22-2 PE=3 SV=1 64 653 0.0E+00
sp|A7KAN0|AT222_PENRW Autophagy-related protein 22-2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg22-2 PE=3 SV=1 64 638 0.0E+00
sp|A1C7M3|AT221_ASPCL Autophagy-related protein 22-1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg22-1 PE=3 SV=1 63 633 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SG38|ATG22_NEUCR Autophagy-related protein 22 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-11 PE=3 SV=1 21 645 0.0E+00
sp|Q2UD74|AT222_ASPOR Autophagy-related protein 22-2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg22-2 PE=3 SV=2 64 616 0.0E+00
sp|Q4WZY1|AT222_ASPFU Autophagy-related protein 22-2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg22-2 PE=3 SV=1 64 653 0.0E+00
sp|A7KAN0|AT222_PENRW Autophagy-related protein 22-2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg22-2 PE=3 SV=1 64 638 0.0E+00
sp|A1C7M3|AT221_ASPCL Autophagy-related protein 22-1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg22-1 PE=3 SV=1 63 633 0.0E+00
sp|A1DI95|AT222_NEOFI Autophagy-related protein 22-2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg22-2 PE=3 SV=1 64 633 0.0E+00
sp|A2QFJ9|AT221_ASPNC Autophagy-related protein 22-1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg22-1 PE=3 SV=2 64 617 0.0E+00
sp|A1C5W7|AT222_ASPCL Autophagy-related protein 22-2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg22-2 PE=3 SV=1 62 616 0.0E+00
sp|Q4WH97|AT221_ASPFU Autophagy-related protein 22-1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg22-1 PE=3 SV=1 57 616 0.0E+00
sp|Q1E8Z0|ATG22_COCIM Autophagy-related protein 22 OS=Coccidioides immitis (strain RS) GN=ATG22 PE=3 SV=3 50 617 0.0E+00
sp|Q2UMJ2|AT221_ASPOR Autophagy-related protein 22-1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg22-1 PE=3 SV=1 60 617 0.0E+00
sp|Q5AW93|AT221_EMENI Autophagy-related protein 22-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg22-1 PE=3 SV=2 52 625 0.0E+00
sp|Q0CL24|AT222_ASPTN Autophagy-related protein 22-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg22-2 PE=3 SV=1 48 617 0.0E+00
sp|Q0U103|AT222_PHANO Autophagy-related protein 22-2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG22-2 PE=3 SV=2 29 635 0.0E+00
sp|A7KAM9|AT221_PENRW Autophagy-related protein 22-1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg22-1 PE=3 SV=1 64 617 0.0E+00
sp|A7EXE6|AT222_SCLS1 Autophagy-related protein 22-2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg22-2 PE=3 SV=1 11 620 0.0E+00
sp|A6S3R7|AT222_BOTFB Autophagy-related protein 22 OS=Botryotinia fuckeliana (strain B05.10) GN=ATG22 PE=3 SV=2 4 654 0.0E+00
sp|Q51IZ9|ATG22_MAGO7 Autophagy-related protein 22 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG22 PE=3 SV=1 65 618 0.0E+00
sp|Q2HFE0|ATG22_CHAGB Autophagy-related protein 22 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG22 PE=3 SV=2 4 645 0.0E+00
sp|A1DG37|AT221_NEOFI Autophagy-related protein 22-1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg22-1 PE=3 SV=1 57 616 0.0E+00
sp|Q0CEJ5|AT221_ASPTN Autophagy-related protein 22-1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg22-1 PE=3 SV=2 63 633 1.0E-179
sp|Q5AVT9|AT222_EMENI Autophagy-related protein 22-2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg22-2 PE=3 SV=1 65 613 8.0E-178
sp|A6SSM3|AT221_BOTFB Autophagy-related protein 22 OS=Botryotinia fuckeliana (strain B05.10) GN=atg22 PE=3 SV=1 60 641 2.0E-174
sp|A7E7N1|AT221_SCLS1 Autophagy-related protein 22-1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg22-1 PE=3 SV=1 60 647 3.0E-174
sp|A2QTX8|AT222_ASPNC Autophagy-related protein 22-2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg22-2 PE=3 SV=1 64 615 2.0E-169
sp|Q0TWF4|AT221_PHANO Autophagy-related protein 22-1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG22-1 PE=3 SV=2 62 613 1.0E-145
sp|Q6CD56|ATG22_YARLI Autophagy-related protein 22 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG22 PE=3 SV=1 70 616 1.0E-112
sp|A7KAK4|ATG22_PICAN Autophagy-related protein 22 OS=Pichia angusta GN=ATG22 PE=3 SV=1 41 617 1.0E-95
sp|Q6FX92|ATG22_CANGA Autophagy-related protein 22 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG22 PE=3 SV=1 38 613 6.0E-90
sp|Q751W1|ATG22_ASHGO Autophagy-related protein 22 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG22 PE=3 SV=1 70 612 6.0E-86
sp|A6ZTF2|ATG22_YEAS7 Autophagy-related protein 22 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG22 PE=3 SV=1 75 615 7.0E-82
sp|P25568|ATG22_YEAST Autophagy-related protein 22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG22 PE=1 SV=1 75 615 2.0E-81
sp|A7TFA9|ATG22_VANPO Autophagy-related protein 22 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG22 PE=3 SV=1 75 613 4.0E-78
sp|P0CM32|ATG22_CRYNJ Autophagy-related protein 22 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG22 PE=3 SV=1 78 613 2.0E-58
sp|P0CM33|ATG22_CRYNB Autophagy-related protein 22 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG22 PE=3 SV=1 78 613 2.0E-58
sp|Q6CUZ1|ATG22_KLULA Autophagy-related protein 22 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG22 PE=3 SV=1 309 612 2.0E-54
sp|Q09812|ATG22_SCHPO Autophagy-related protein 22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg22 PE=3 SV=1 56 599 3.0E-43
sp|Q6CUZ1|ATG22_KLULA Autophagy-related protein 22 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG22 PE=3 SV=1 75 235 9.0E-22
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

Domain # Start End Length
1 82 104 22
2 148 170 22
3 183 202 19
4 206 228 22
5 316 338 22
6 348 367 19
7 412 434 22
8 444 466 22
9 479 501 22
10 516 538 22
11 550 572 22
12 582 599 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5064
MPSPQAENPPLLPGRRISPPAKRSLDVRSGSSDEADDERSDSEDDDDDDDNNNNNMTSPGILRPRYSGYDARPTS
RKELMGWYMYAFAAETYVICGIASFIPILLESLARENGVLLSDPTKPCGSSDSKTQDDDGQCVVYVLGLEINTAS
FAMYTFSVSVALQALLVVSISCAADHGNYRKKLLLVFAWIGGLAVMCYIFISKATYILGAVLTIISNTSFGASFV
LLNSFLPLLVRNHPDVIEARGPQTPDLAASGLESRPLEDSVGELDPSVTNSTSALLAHEAAASGWRLKQGATAEE
ITSKELQLSTRLSAQGIGVGYSAALFVQCVSIAILILMKNTTWAQRVVLFFVGSWWSFFTIPAALWLRPRPGPPL
TGDARKGRLSWISYLTFAWKSLWRTVRLARRLVDITLFLAGWFLLSDAIATTSSTAILFAKTQLHMRPWALGMIN
VIVTLTGVLGAFGWSWVSRALGIQAHQTILVCIGLFELIPLYGLLGYLPFVERWGVVGLQRPWEMYPLAAIYGLV
MGGLSSYCRSLYGELIPPGSEAAFYALYAITDKGSSIFGPTIVGAIIDRTGSIRPAFWFLAALVGLPAPLIWFID
VERGKREGDKLAEAIEGFTVVRRGDPLLEEEEGRDMMADYDGVEDGQSGAVRRRP
Coding >Ophio5|5064
ATGCCCTCGCCTCAGGCCGAGAATCCGCCGCTTCTCCCCGGCCGGCGCATCTCTCCGCCAGCCAAGCGCTCGCTA
GACGTCCGCTCGGGTTCCTCGGACGAGGCCGACGACGAGCGCTCTGATTCCGAAGACGACGACGACGACGACGAC
AACAACAACAACAACATGACTTCTCCCGGGATTCTGCGTCCGCGCTACTCGGGCTACGATGCGCGTCCGACCAGT
CGCAAGGAGCTGATGGGCTGGTACATGTATGCCTTCGCCGCCGAGACCTATGTCATCTGCGGCATTGCTTCTTTC
ATCCCCATACTGCTCGAGTCGCTGGCGCGCGAAAATGGCGTCCTGCTTTCCGATCCGACCAAGCCCTGCGGCTCC
AGCGATAGCAAGACGCAAGATGACGATGGCCAGTGCGTCGTCTATGTCCTCGGGCTCGAGATCAACACCGCCAGC
TTCGCCATGTATACCTTCTCCGTCAGCGTCGCGCTTCAGGCGCTTCTCGTCGTGAGCATCAGCTGCGCCGCCGAT
CATGGCAACTATCGCAAGAAGCTTCTCCTCGTCTTTGCTTGGATCGGTGGTCTGGCCGTCATGTGCTACATCTTC
ATCAGCAAGGCGACGTACATTCTCGGTGCCGTCTTGACCATCATATCCAACACGTCTTTCGGCGCATCCTTTGTC
CTGCTCAACTCCTTTTTGCCGCTGCTGGTGAGGAATCATCCCGATGTCATCGAGGCGCGTGGGCCCCAGACGCCT
GACTTGGCCGCCTCCGGCCTCGAGTCGCGCCCGCTTGAAGACTCGGTCGGCGAGCTGGACCCGTCTGTTACCAAT
TCGACCTCGGCGCTACTGGCCCATGAGGCGGCCGCCTCTGGGTGGCGGCTCAAACAAGGCGCGACGGCTGAAGAG
ATAACGTCCAAAGAGCTGCAGCTATCGACACGCCTGTCGGCCCAGGGCATTGGGGTTGGGTACAGCGCGGCCCTC
TTCGTCCAGTGCGTCTCCATCGCCATCTTAATCCTCATGAAGAACACCACTTGGGCCCAGCGCGTCGTTCTCTTC
TTCGTCGGCTCCTGGTGGTCCTTCTTCACCATCCCCGCCGCCCTCTGGCTGCGGCCTAGGCCGGGACCTCCGTTG
ACGGGCGACGCTCGCAAGGGCCGTCTCTCGTGGATTTCATATCTGACGTTTGCGTGGAAGTCGTTGTGGCGCACC
GTCAGGCTCGCCCGTCGGCTGGTGGACATTACGCTTTTCCTCGCCGGTTGGTTCCTCCTGTCCGATGCCATCGCC
ACGACATCCTCGACAGCCATTCTGTTCGCCAAGACGCAGCTTCACATGCGGCCTTGGGCCCTGGGCATGATCAAC
GTCATCGTCACGCTGACGGGCGTCTTGGGCGCCTTTGGCTGGTCGTGGGTGTCGCGCGCCTTGGGGATACAAGCT
CACCAGACCATCTTGGTCTGCATCGGCCTCTTCGAGCTGATCCCCCTCTACGGCCTGCTCGGCTACCTGCCGTTC
GTCGAGAGATGGGGCGTCGTGGGCCTCCAGCGGCCGTGGGAGATGTACCCGCTGGCGGCCATATACGGCCTCGTC
ATGGGAGGTCTGAGCAGCTACTGCCGGTCGCTGTACGGAGAGCTGATACCGCCGGGGTCCGAGGCCGCCTTTTAC
GCGCTGTACGCCATCACCGACAAGGGCTCCAGCATCTTCGGGCCGACCATTGTCGGCGCCATCATCGACCGCACC
GGAAGCATCCGGCCGGCGTTTTGGTTCCTGGCGGCGCTCGTGGGCCTCCCGGCGCCGCTGATATGGTTCATCGAT
GTCGAGAGGGGTAAGAGAGAAGGCGACAAGCTGGCTGAGGCTATAGAGGGCTTCACCGTCGTGCGTCGGGGGGAC
CCGCTACTGGAGGAGGAGGAGGGCCGGGACATGATGGCCGACTATGACGGCGTCGAGGACGGCCAGTCGGGGGCG
GTAAGGAGACGGCCA
Transcript >Ophio5|5064
ATGCCCTCGCCTCAGGCCGAGAATCCGCCGCTTCTCCCCGGCCGGCGCATCTCTCCGCCAGCCAAGCGCTCGCTA
GACGTCCGCTCGGGTTCCTCGGACGAGGCCGACGACGAGCGCTCTGATTCCGAAGACGACGACGACGACGACGAC
AACAACAACAACAACATGACTTCTCCCGGGATTCTGCGTCCGCGCTACTCGGGCTACGATGCGCGTCCGACCAGT
CGCAAGGAGCTGATGGGCTGGTACATGTATGCCTTCGCCGCCGAGACCTATGTCATCTGCGGCATTGCTTCTTTC
ATCCCCATACTGCTCGAGTCGCTGGCGCGCGAAAATGGCGTCCTGCTTTCCGATCCGACCAAGCCCTGCGGCTCC
AGCGATAGCAAGACGCAAGATGACGATGGCCAGTGCGTCGTCTATGTCCTCGGGCTCGAGATCAACACCGCCAGC
TTCGCCATGTATACCTTCTCCGTCAGCGTCGCGCTTCAGGCGCTTCTCGTCGTGAGCATCAGCTGCGCCGCCGAT
CATGGCAACTATCGCAAGAAGCTTCTCCTCGTCTTTGCTTGGATCGGTGGTCTGGCCGTCATGTGCTACATCTTC
ATCAGCAAGGCGACGTACATTCTCGGTGCCGTCTTGACCATCATATCCAACACGTCTTTCGGCGCATCCTTTGTC
CTGCTCAACTCCTTTTTGCCGCTGCTGGTGAGGAATCATCCCGATGTCATCGAGGCGCGTGGGCCCCAGACGCCT
GACTTGGCCGCCTCCGGCCTCGAGTCGCGCCCGCTTGAAGACTCGGTCGGCGAGCTGGACCCGTCTGTTACCAAT
TCGACCTCGGCGCTACTGGCCCATGAGGCGGCCGCCTCTGGGTGGCGGCTCAAACAAGGCGCGACGGCTGAAGAG
ATAACGTCCAAAGAGCTGCAGCTATCGACACGCCTGTCGGCCCAGGGCATTGGGGTTGGGTACAGCGCGGCCCTC
TTCGTCCAGTGCGTCTCCATCGCCATCTTAATCCTCATGAAGAACACCACTTGGGCCCAGCGCGTCGTTCTCTTC
TTCGTCGGCTCCTGGTGGTCCTTCTTCACCATCCCCGCCGCCCTCTGGCTGCGGCCTAGGCCGGGACCTCCGTTG
ACGGGCGACGCTCGCAAGGGCCGTCTCTCGTGGATTTCATATCTGACGTTTGCGTGGAAGTCGTTGTGGCGCACC
GTCAGGCTCGCCCGTCGGCTGGTGGACATTACGCTTTTCCTCGCCGGTTGGTTCCTCCTGTCCGATGCCATCGCC
ACGACATCCTCGACAGCCATTCTGTTCGCCAAGACGCAGCTTCACATGCGGCCTTGGGCCCTGGGCATGATCAAC
GTCATCGTCACGCTGACGGGCGTCTTGGGCGCCTTTGGCTGGTCGTGGGTGTCGCGCGCCTTGGGGATACAAGCT
CACCAGACCATCTTGGTCTGCATCGGCCTCTTCGAGCTGATCCCCCTCTACGGCCTGCTCGGCTACCTGCCGTTC
GTCGAGAGATGGGGCGTCGTGGGCCTCCAGCGGCCGTGGGAGATGTACCCGCTGGCGGCCATATACGGCCTCGTC
ATGGGAGGTCTGAGCAGCTACTGCCGGTCGCTGTACGGAGAGCTGATACCGCCGGGGTCCGAGGCCGCCTTTTAC
GCGCTGTACGCCATCACCGACAAGGGCTCCAGCATCTTCGGGCCGACCATTGTCGGCGCCATCATCGACCGCACC
GGAAGCATCCGGCCGGCGTTTTGGTTCCTGGCGGCGCTCGTGGGCCTCCCGGCGCCGCTGATATGGTTCATCGAT
GTCGAGAGGGGTAAGAGAGAAGGCGACAAGCTGGCTGAGGCTATAGAGGGCTTCACCGTCGTGCGTCGGGGGGAC
CCGCTACTGGAGGAGGAGGAGGGCCGGGACATGATGGCCGACTATGACGGCGTCGAGGACGGCCAGTCGGGGGCG
GTAAGGAGACGGCCATAG
Gene >Ophio5|5064
ATGCCCTCGCCTCAGGCCGAGAATCCGCCGCTTCTCCCCGGCCGGCGCATCTCTCCGCCAGCCAAGCGCTCGCTA
GACGTCCGCTCGGGTTCCTCGGACGAGGCCGACGACGAGCGCTCTGATTCCGAAGACGACGACGACGACGACGAC
AACAACAACAACAACATGACTTCTCCCGGGATTCTGCGTCCGCGCTACTCGGGCTACGATGCGCGTCCGACCAGT
CGCAAGGAGCTGATGGGCTGGTACATGTATGCCTTCGCCGCCGAGACCTATGTCATCTGCGGCATTGGTGAGCTC
GTCGTTCCTCAGAGGCCTTTCCGGCTGAGCTCATACTTCTTTCCGCCAGCTTCTTTCATCCCCATACTGCTCGAG
TCGCTGGCGCGCGAAAATGGCGTCCTGCTTTCCGATCCGACCAAGCCCTGCGGCTCCAGCGATAGCAAGACGCAA
GATGACGATGGCCAGTGCGTCGTCTATGTCCTCGGGCTCGAGATCAACACCGCCAGCTTCGCCATGTATACCTTC
TCCGTCAGCGTCGCGCTTCAGGCGCTTCTCGTCGTGAGCATCAGCTGCGCCGCCGATCATGGCAACTATCGCAAG
AAGCTTCTCCTCGTCTTTGCTTGGATCGGTGGTCTGGCCGTCATGTGCTACATCTTCATCAGCAAGGCGACGTAC
ATTCTCGGTGCCGTCTTGACCATCATATCCAACACGTCTTTCGGCGCATCCTTTGTCCTGCTCAACTCCTTTTTG
CCGCTGCTGGTGAGGAATCATCCCGATGTCATCGAGGCGCGTGGGCCCCAGACGCCTGACTTGGCCGCCTCCGGC
CTCGAGTCGCGCCCGCTTGAAGACTCGGTCGGCGAGCTGGACCCGTCTGTTACCAATTCGACCTCGGCGCTACTG
GCCCATGAGGCGGCCGCCTCTGGGTGGCGGCTCAAACAAGGCGCGACGGCTGAAGAGATAACGTCCAAAGAGCTG
CAGCTATCGACACGCCTGTCGGCCCAGGGCATTGGGGTTGGGTACAGCGCGGCCCTCTTCGTCCAGTGCGTCTCC
ATCGCCATCTTAATCCTCATGAAGAACACCACTTGGGCCCAGCGCGTCGTTCTCTTCTTCGTCGGCTCCTGGTGG
TCCTTCTTCACCATCCCCGCCGCCCTCTGGCTGCGGCCTAGGCCGGGACCTCCGTTGACGGGCGACGCTCGCAAG
GGCCGTCTCTCGTGGATTTCATATCTGACGTTTGCGTGGAAGTCGTTGTGGCGCACCGTCAGGCTCGCCCGTCGG
CTGGTGGACATTACGCTTTTCCTCGCCGGTTGGTTCCTCCTGTCCGATGCCATCGCCACGACATCCTCGACAGCC
ATTCTGTTCGCCAAGACGCAGCTTCACATGCGGCCTTGGGCCCTGGGCATGATCAACGTCATCGTCACGCTGACG
GGCGTCTTGGGCGCCTTTGGCTGGTCGTGGGTGTCGCGCGCCTTGGGGATACAAGCTCACCAGACCATCTTGGTC
TGCATCGGCCTCTTCGAGCTGATCCCCCTCTACGGCCTGCTCGGCTACCTGCCGTTCGTCGAGAGATGGGGCGTC
GTGGGCCTCCAGCGGCCGTGGGAGATGTACCCGCTGGCGGCCATATACGGCCTCGTCATGGGAGGTCTGAGCAGC
TACTGCCGGTCGCTGTACGGAGAGCTGATACCGCCGGGGTCCGAGGCCGCCTTTTACGCGCTGTACGCCATCACC
GACAAGGGCTCCAGCATCTTCGGGCCGACCATTGTCGGCGCCATCATCGACCGCACCGGAAGCATCCGGCCGGCG
TTTTGGTTCCTGGCGGCGCTCGTGGGCCTCCCGGCGCCGCTGATATGGTTCATCGATGTCGAGAGGGGTAAGAGA
GAAGGCGACAAGCTGGCTGAGGCTATAGAGGGCTTCACCGTCGTGCGTCGGGGGGACCCGCTACTGGAGGAGGAG
GAGGGCCGGGACATGATGGCCGACTATGACGGCGTCGAGGACGGCCAGTCGGGGGCGGTAAGGAGACGGCCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail