Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5058
Gene name
Locationscaffold_406:410..2715
Strand-
Gene length (bp)2305
Transcript length (bp)1464
Coding sequence length (bp)1461
Protein length (aa) 487

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1778 0.1941 0.9305 0.0947 0.0872 0.0162 0.1167 0.1075 0.1147 0.0013

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA11 1.7E-76 92 288

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4007
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4017
Ophiocordyceps australis map64 (Brazil) OphauB2|1375
Ophiocordyceps camponoti-floridani Ophcf2|05846
Ophiocordyceps camponoti-rufipedis Ophun1|3275
Ophiocordyceps kimflemingae Ophio5|5058 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8041

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5058
MFSRLLCHARVSVPNGHVQRPSVRFPTVFCGPYIPSCQTLQPAESLIVWNGEEHRPLGNPVFLDILGHIDITFEM
MLKAITVAGLAATGSAHIMISNPVPFGKSSLTNSPLANDGSDFPCKQRSGVYDADGASNVYKQGSTQQLEFRGSA
VHGGGSCQVSMTTDLKPTKNSVWKVIKSIEGGCPAKNQGGNMGGGAGADTPYKYDYTIPTELAAGNYTLAWTWFN
KIGNREMYMNCAPVSVTGSGGSQGYLESLPDMFVANVGKGCGTESGKDVQFPNPGKDVDRFNGATSAFAPPTGSC
PTGNSGGGGNQGGGSYQPPPTAKPSPPAEKPSPPAEKPSYKPEPSSEAAPSSSYETSVGAPSYAAPQPTAATTSA
AYEASVPGAVFATVSDSPSAPSQAAAPTPEAPAAPGNGTAPSEGHAAGTACSPEGTWNCLGKSFQRCASGQWSVV
QNMAAGTACTPGESAELKMSAANVRRSMRGGFRYYAA
Coding >Ophio5|5058
ATGTTCTCACGACTGTTGTGCCACGCCAGAGTCTCCGTTCCAAACGGCCACGTTCAAAGACCATCTGTTCGCTTC
CCAACCGTCTTCTGCGGACCTTACATTCCCTCTTGCCAAACTCTACAGCCCGCCGAGTCTCTCATCGTCTGGAAC
GGTGAAGAACATCGACCTCTTGGCAACCCCGTTTTTCTCGACATCCTTGGACATATCGATATCACCTTCGAAATG
ATGCTCAAGGCCATCACTGTCGCCGGCCTGGCCGCCACTGGCAGCGCCCACATCATGATCAGCAACCCCGTGCCG
TTTGGCAAGTCGAGCCTCACCAACAGCCCCCTGGCCAACGACGGCTCCGACTTCCCCTGCAAGCAGCGCAGCGGC
GTCTACGATGCCGACGGCGCCAGCAACGTCTACAAGCAGGGCAGTACGCAGCAGCTCGAGTTCCGCGGCTCGGCC
GTCCACGGCGGAGGCTCGTGCCAAGTGTCGATGACGACGGACCTCAAGCCGACCAAGAATTCGGTCTGGAAGGTC
ATCAAGTCCATTGAGGGCGGCTGTCCCGCCAAGAACCAGGGCGGCAACATGGGAGGAGGCGCTGGCGCCGACACT
CCCTACAAGTACGACTACACCATTCCCACCGAGCTCGCTGCCGGAAACTACACGCTGGCGTGGACCTGGTTCAAC
AAGATCGGCAACCGAGAGATGTACATGAACTGTGCGCCCGTCAGCGTCACGGGCTCCGGTGGCTCGCAGGGTTAT
CTCGAGTCGCTGCCGGACATGTTTGTCGCCAACGTCGGCAAGGGATGTGGCACCGAGTCTGGCAAAGATGTGCAG
TTCCCCAACCCGGGCAAGGACGTCGACCGCTTCAACGGTGCCACCTCTGCCTTTGCGCCCCCAACCGGCTCGTGC
CCGACTGGCAACTCCGGCGGCGGCGGAAACCAAGGAGGGGGCAGCTACCAGCCGCCCCCCACGGCCAAGCCCTCG
CCCCCAGCCGAGAAGCCCTCGCCTCCGGCTGAGAAGCCCTCTTACAAGCCCGAGCCGTCCTCGGAAGCCGCCCCC
TCGTCCTCGTACGAGACCAGCGTGGGCGCCCCGAGCTACGCTGCCCCCCAGCCCACGGCGGCGACCACGTCGGCG
GCCTACGAAGCCAGCGTCCCCGGCGCCGTCTTCGCCACCGTCAGCGACTCTCCTTCGGCGCCGAGCCAGGCCGCC
GCTCCCACCCCCGAGGCCCCAGCCGCCCCGGGCAATGGCACGGCGCCGTCCGAGGGCCACGCCGCGGGAACGGCC
TGCTCGCCAGAGGGAACTTGGAACTGTCTGGGCAAGTCCTTCCAGCGTTGCGCTAGCGGGCAGTGGTCCGTCGTT
CAGAACATGGCCGCCGGCACGGCCTGCACTCCCGGCGAGTCTGCCGAGCTGAAGATGTCTGCCGCCAACGTCAGG
CGGTCCATGCGCGGCGGCTTCCGCTACTACGCTGCC
Transcript >Ophio5|5058
ATGTTCTCACGACTGTTGTGCCACGCCAGAGTCTCCGTTCCAAACGGCCACGTTCAAAGACCATCTGTTCGCTTC
CCAACCGTCTTCTGCGGACCTTACATTCCCTCTTGCCAAACTCTACAGCCCGCCGAGTCTCTCATCGTCTGGAAC
GGTGAAGAACATCGACCTCTTGGCAACCCCGTTTTTCTCGACATCCTTGGACATATCGATATCACCTTCGAAATG
ATGCTCAAGGCCATCACTGTCGCCGGCCTGGCCGCCACTGGCAGCGCCCACATCATGATCAGCAACCCCGTGCCG
TTTGGCAAGTCGAGCCTCACCAACAGCCCCCTGGCCAACGACGGCTCCGACTTCCCCTGCAAGCAGCGCAGCGGC
GTCTACGATGCCGACGGCGCCAGCAACGTCTACAAGCAGGGCAGTACGCAGCAGCTCGAGTTCCGCGGCTCGGCC
GTCCACGGCGGAGGCTCGTGCCAAGTGTCGATGACGACGGACCTCAAGCCGACCAAGAATTCGGTCTGGAAGGTC
ATCAAGTCCATTGAGGGCGGCTGTCCCGCCAAGAACCAGGGCGGCAACATGGGAGGAGGCGCTGGCGCCGACACT
CCCTACAAGTACGACTACACCATTCCCACCGAGCTCGCTGCCGGAAACTACACGCTGGCGTGGACCTGGTTCAAC
AAGATCGGCAACCGAGAGATGTACATGAACTGTGCGCCCGTCAGCGTCACGGGCTCCGGTGGCTCGCAGGGTTAT
CTCGAGTCGCTGCCGGACATGTTTGTCGCCAACGTCGGCAAGGGATGTGGCACCGAGTCTGGCAAAGATGTGCAG
TTCCCCAACCCGGGCAAGGACGTCGACCGCTTCAACGGTGCCACCTCTGCCTTTGCGCCCCCAACCGGCTCGTGC
CCGACTGGCAACTCCGGCGGCGGCGGAAACCAAGGAGGGGGCAGCTACCAGCCGCCCCCCACGGCCAAGCCCTCG
CCCCCAGCCGAGAAGCCCTCGCCTCCGGCTGAGAAGCCCTCTTACAAGCCCGAGCCGTCCTCGGAAGCCGCCCCC
TCGTCCTCGTACGAGACCAGCGTGGGCGCCCCGAGCTACGCTGCCCCCCAGCCCACGGCGGCGACCACGTCGGCG
GCCTACGAAGCCAGCGTCCCCGGCGCCGTCTTCGCCACCGTCAGCGACTCTCCTTCGGCGCCGAGCCAGGCCGCC
GCTCCCACCCCCGAGGCCCCAGCCGCCCCGGGCAATGGCACGGCGCCGTCCGAGGGCCACGCCGCGGGAACGGCC
TGCTCGCCAGAGGGAACTTGGAACTGTCTGGGCAAGTCCTTCCAGCGTTGCGCTAGCGGGCAGTGGTCCGTCGTT
CAGAACATGGCCGCCGGCACGGCCTGCACTCCCGGCGAGTCTGCCGAGCTGAAGATGTCTGCCGCCAACGTCAGG
CGGTCCATGCGCGGCGGCTTCCGCTACTACGCTGCCTGA
Gene >Ophio5|5058
ATGTGTGCGTGCCATTCCAGGGCGCTTGTTCTCGTGGGGCTTCGATCACTCTCTTTCTAGTCGATAGACCCTTGT
TCCTTTCCATTGGCGCTTGGTTTACCATCTAATCCTCAAGCCCCTGGATGTCTGTCGGAGGCTAGGGCTGGAGGA
GGAAGGAGGGTAGGGAGAAGACCGATATAAGACTCTTCGTCTCTGCTCGCCTGCCTCCTCCTCTGCCAAGCCAGC
TCTCCATCTCATTCTTTTCTCTCCTGTCCAGAGGTGCCTGTCGTCAAGAACGACTTCCTTTCCCTCTCGTCACTT
GTTCTTTTCGCGTCTTCTTCCGAGGCTAGACCTCGTTGCTGTTTGCTTGTCGCCGTTATTCTTCATCTGAAACGA
CTGAAAAAGACAACAGTCTCACGACTGTTGTGCCACGCCAGAGTCTCCGTTCCAAACGGCCACGTTCAAAGAGTG
AGTGAGTAATACGTTCCCTCGTCGCTCGGCGCTTCGGCTAGGTACTTGAGCAAAGTGGCAGGCTTTTCATTTTCC
CATTTCAGAATTACAGCCCCTCCCCCGATTTTTTGTTTTGCCTCTTCACGGCCTGTCTAGCCTTGTGTTTTCATA
TCATTCCATGCCAAGTATATGTAGTGCCCCTGCGTCGGGGTGAATGTGTTTGCCTGTGGTGAGCCTGTTCTGTTC
ACCCTTCAACTTTTTTTTCTTTAACGTCTTGCCATGTTTGTTCTCGTGGCCCTATTGGTTCTGGATGAAAGGCCC
CAGCATCTGAACCGTCATTGCAATACCCCATTGTCTGCCAATTCTTCATTCTGACTCTTCTATTGTCGCAGCCAT
CTGTTCGCTTCCCAACCGTCTTCTGCGGACCTTACATTCCCTCTTGGTCTCGACACCTTGATCCGACCACCCAAA
TTTTTTTTCCCTTCCTCCTCTTTTGAAGGAGAAAAGAAATATAGATACCAGCCAAACTCTACAGCCCGCCGAGTC
TCTCATCGTCTGGAACGGTGAAGAACATCGACCTCTTGGCAACCCCGTTTTTCTCGACATCCTTGGACATATCGA
TATCACCTTCGAAATGATGCTCAAGGCCATCACTGTCGCCGGCCTGGCCGCCACTGGCAGCGCCCACATCATGAT
CAGCAACCCCGTGCCGTTTGGCAAGTCGAGCCTCACCAACAGCCCCCTGGCCAACGACGGCTCCGACTTCCCCTG
CAAGCAGCGCAGCGGCGTCTACGATGCCGACGGCGCCAGCAACGTCTACAAGCAGGGCAGTACGCAGCAGCTCGA
GTTCCGCGGCTCGGCCGTCCACGGCGGAGGCTCGTGCCAAGTGTCGATGACGACGGACCTCAAGCCGACCAAGAA
TTCGGTCTGGAAGGTCATCAAGTCCATTGAGGGCGGCTGTCCCGCCAAGAACCAGGGCGGCAACATGGGAGGAGG
CGCTGGCGCCGACACTCCCTACAAGTACGACTACACCATTCCCACCGAGCTCGCTGCCGGAAACTACACGCTGGC
GTGGACCTGGTTCAACAAGATCGGCAACCGAGAGATGTACATGAACTGTGCGCCCGTCAGCGTCACGGGCTCCGG
TGGCTCGCAGGGTTATCTCGAGTCGCTGCCGGACATGTTTGTCGCCAACGTCGGCAAGGGATGTGGCACCGAGTC
TGGCAAAGATGTGCAGTTCCCCAACCCGGGCAAGGACGTCGACCGCTTCAACGGTGCCACCTCTGCCTTTGCGCC
CCCAACCGGCTCGTGCCCGACTGGCAACTCCGGCGGCGGCGGAAACCAAGGAGGGGGCAGCTACCAGCCGCCCCC
CACGGCCAAGCCCTCGCCCCCAGCCGAGAAGCCCTCGCCTCCGGCTGAGAAGCCCTCTTACAAGCCCGAGCCGTC
CTCGGAAGCCGCCCCCTCGTCCTCGTACGAGACCAGCGTGGGCGCCCCGAGCTACGCTGCCCCCCAGCCCACGGC
GGCGACCACGTCGGCGGCCTACGAAGCCAGCGTCCCCGGCGCCGTCTTCGCCACCGTCAGCGACTCTCCTTCGGC
GCCGAGCCAGGCCGCCGCTCCCACCCCCGAGGCCCCAGCCGCCCCGGGCAATGGCACGGCGCCGTCCGAGGGCCA
CGCCGCGGGAACGGCCTGCTCGCCAGAGGGAACTTGGAACTGTCTGGGCAAGTCCTTCCAGCGTTGCGCTAGCGG
GCAGTGGTCCGTCGTTCAGAACATGGCCGCCGGCACGGCCTGCACTCCCGGCGAGTCTGCCGAGCTGAAGATGTC
TGCCGCCAACGTCAGGCGGTCCATGCGCGGCGGCTTCCGCTACTACGCTGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail