Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5053
Gene name
Locationscaffold_405:6246..7572
Strand+
Gene length (bp)1326
Transcript length (bp)1149
Coding sequence length (bp)1146
Protein length (aa) 382

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00804 Syntaxin Syntaxin 1.9E-20 80 269
PF05739 SNARE SNARE domain 7.8E-10 276 323

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USH7|PSY1_SCHPO Syntaxin-like protein psy1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psy1 PE=3 SV=1 79 313 3.0E-47
sp|Q59YF0|SSO2_CANAL Protein transport protein SSO2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSO2 PE=3 SV=1 29 330 3.0E-39
sp|P32867|SSO1_YEAST Protein SSO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSO1 PE=1 SV=2 74 311 7.0E-36
sp|P39926|SSO2_YEAST Protein SSO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSO2 PE=1 SV=2 59 321 6.0E-34
sp|P32856|STX2_HUMAN Syntaxin-2 OS=Homo sapiens GN=STX2 PE=2 SV=3 163 326 1.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USH7|PSY1_SCHPO Syntaxin-like protein psy1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psy1 PE=3 SV=1 79 313 3.0E-47
sp|Q59YF0|SSO2_CANAL Protein transport protein SSO2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSO2 PE=3 SV=1 29 330 3.0E-39
sp|P32867|SSO1_YEAST Protein SSO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSO1 PE=1 SV=2 74 311 7.0E-36
sp|P39926|SSO2_YEAST Protein SSO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSO2 PE=1 SV=2 59 321 6.0E-34
sp|P32856|STX2_HUMAN Syntaxin-2 OS=Homo sapiens GN=STX2 PE=2 SV=3 163 326 1.0E-15
sp|O16000|STX1A_CAEEL Syntaxin-1A homolog OS=Caenorhabditis elegans GN=unc-64 PE=1 SV=1 148 333 1.0E-13
sp|P32851|STX1A_RAT Syntaxin-1A OS=Rattus norvegicus GN=Stx1a PE=1 SV=1 146 322 3.0E-13
sp|O35526|STX1A_MOUSE Syntaxin-1A OS=Mus musculus GN=Stx1a PE=1 SV=3 146 322 4.0E-13
sp|Q16623|STX1A_HUMAN Syntaxin-1A OS=Homo sapiens GN=STX1A PE=1 SV=1 146 326 6.0E-13
sp|P32850|STX1A_BOVIN Syntaxin-1A OS=Bos taurus GN=STX1A PE=1 SV=1 146 331 9.0E-13
sp|Q5R4L2|STX1A_PONAB Syntaxin-1A OS=Pongo abelii GN=STX1A PE=2 SV=1 146 326 3.0E-12
sp|Q24547|STX1A_DROME Syntaxin-1A OS=Drosophila melanogaster GN=Syx1A PE=1 SV=1 146 314 3.0E-12
sp|Q00262|STX2_MOUSE Syntaxin-2 OS=Mus musculus GN=Stx2 PE=1 SV=1 106 309 2.0E-10
sp|Q9SRV7|SY131_ARATH Putative syntaxin-131 OS=Arabidopsis thaliana GN=SYP131 PE=3 SV=1 163 312 6.0E-10
sp|P70452|STX4_MOUSE Syntaxin-4 OS=Mus musculus GN=Stx4 PE=1 SV=1 153 323 7.0E-10
sp|P50279|STX2_RAT Syntaxin-2 OS=Rattus norvegicus GN=Stx2 PE=1 SV=2 163 309 7.0E-10
sp|Q08850|STX4_RAT Syntaxin-4 OS=Rattus norvegicus GN=Stx4 PE=1 SV=1 153 323 8.0E-10
sp|Q13277|STX3_HUMAN Syntaxin-3 OS=Homo sapiens GN=STX3 PE=1 SV=3 145 307 8.0E-10
sp|P61266|STX1B_HUMAN Syntaxin-1B OS=Homo sapiens GN=STX1B PE=1 SV=1 146 327 9.0E-10
sp|P61264|STX1B_MOUSE Syntaxin-1B OS=Mus musculus GN=Stx1b PE=1 SV=1 146 327 9.0E-10
sp|P61265|STX1B_RAT Syntaxin-1B OS=Rattus norvegicus GN=Stx1b PE=1 SV=1 146 327 9.0E-10
sp|P61268|STX1B_SHEEP Syntaxin-1B OS=Ovis aries GN=STX1B PE=2 SV=1 146 327 9.0E-10
sp|P61267|STX1B_BOVIN Syntaxin-1B OS=Bos taurus GN=STX1B PE=1 SV=1 146 327 9.0E-10
sp|Q16932|STX_APLCA Syntaxin OS=Aplysia californica PE=2 SV=1 143 313 1.0E-09
sp|Q12846|STX4_HUMAN Syntaxin-4 OS=Homo sapiens GN=STX4 PE=1 SV=2 61 328 1.0E-09
sp|A8WVD0|STX1A_CAEBR Syntaxin-1A OS=Caenorhabditis briggsae GN=unc-64 PE=3 SV=1 148 308 2.0E-09
sp|Q7KVY7|STX4_DROME Syntaxin-4 OS=Drosophila melanogaster GN=Syx4 PE=2 SV=1 74 308 2.0E-09
sp|Q08849|STX3_RAT Syntaxin-3 OS=Rattus norvegicus GN=Stx3 PE=2 SV=1 145 307 6.0E-09
sp|Q64704|STX3_MOUSE Syntaxin-3 OS=Mus musculus GN=Stx3 PE=1 SV=1 145 307 6.0E-09
sp|Q8VZU2|SY132_ARATH Syntaxin-132 OS=Arabidopsis thaliana GN=SYP132 PE=1 SV=1 191 311 6.0E-08
sp|Q3SWZ3|STX4_BOVIN Syntaxin-4 OS=Bos taurus GN=STX4 PE=2 SV=1 63 315 9.0E-08
sp|O64791|SY124_ARATH Syntaxin-124 OS=Arabidopsis thaliana GN=SYP124 PE=2 SV=1 149 330 9.0E-08
sp|Q9D3G5|STX11_MOUSE Syntaxin-11 OS=Mus musculus GN=Stx11 PE=1 SV=1 156 317 3.0E-07
sp|Q42374|SY111_ARATH Syntaxin-related protein KNOLLE OS=Arabidopsis thaliana GN=KN PE=1 SV=1 151 311 3.0E-07
sp|O75558|STX11_HUMAN Syntaxin-11 OS=Homo sapiens GN=STX11 PE=1 SV=1 122 317 9.0E-07
sp|Q9SVC2|SY122_ARATH Syntaxin-122 OS=Arabidopsis thaliana GN=SYP122 PE=1 SV=1 59 313 2.0E-06
sp|Q9P6P1|TLG2_SCHPO t-SNARE affecting a late Golgi compartment protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tlg2 PE=3 SV=1 176 334 2.0E-06
sp|Q20024|STX3_CAEEL Putative syntaxin-3 OS=Caenorhabditis elegans GN=syx-3 PE=3 SV=3 75 327 4.0E-06
sp|Q9ZQZ8|SY123_ARATH Syntaxin-123 OS=Arabidopsis thaliana GN=SYP123 PE=2 SV=1 165 313 5.0E-06
sp|Q54JY7|STX7A_DICDI Syntaxin-7A OS=Dictyostelium discoideum GN=syn7A PE=1 SV=1 220 334 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 309 331 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5053
MAQQYGYGARQNPFDQRDDAPAYGAPLRQPTGGGYGQTSSYGGGRGYNQSMDAGYSGGNVEMASLAQNAGSFAGG
DPNQILNECRDIDRGIDQVESNLGSLRMLQKRTLDDADSSSSSAANRQLDALSSETMSLYRSLTERIRTVKSNPD
SRTPKNNPQVGRVDRRLKAAIQQYQQVESEFRKRTQEQMARQYRIVRPDASESEIRAAVEDTNGGQVFSQALMQS
DRQGRARAALSAVEDRHAALIKIEQQIVELAQLFQDMDTLVVQQDAAVLQIEQKGEEVIDNLDKGNEEIGVAVKT
ARKTRKKKWICLGISIIILIIIVVVVLVYIFVVRGGPQNLVNNGNNNNNDNANKPAKRSPMELMDWMKGPQGMSF
PVILPDA
Coding >Ophio5|5053
ATGGCGCAACAGTACGGATACGGTGCGAGACAGAACCCCTTCGACCAAAGGGACGATGCTCCTGCCTACGGCGCG
CCCTTGAGGCAGCCGACCGGAGGAGGTTATGGTCAGACGTCATCCTACGGCGGCGGCCGAGGCTACAACCAGTCC
ATGGATGCCGGCTACTCAGGTGGCAATGTCGAGATGGCATCCCTTGCCCAGAACGCGGGCTCCTTTGCCGGCGGC
GATCCCAACCAGATTCTCAACGAGTGCAGAGATATCGACCGCGGCATCGATCAGGTCGAGAGCAATCTCGGAAGT
CTTCGCATGCTGCAGAAGCGGACGCTGGACGACGCCGACAGCTCCTCGTCTAGCGCCGCCAACCGCCAGCTCGAT
GCCCTCTCCTCCGAAACCATGTCGCTCTACCGCAGCCTCACCGAGCGCATCCGCACCGTCAAGTCCAATCCCGAC
TCTCGCACCCCCAAGAACAACCCTCAAGTTGGCCGCGTCGACCGACGGTTGAAGGCGGCCATTCAGCAGTATCAG
CAGGTCGAGTCTGAGTTCCGTAAGCGCACGCAGGAACAAATGGCACGCCAGTATCGCATCGTCCGCCCTGACGCC
TCCGAGAGCGAGATCCGCGCCGCCGTCGAGGACACAAATGGCGGTCAAGTCTTTAGCCAGGCCCTGATGCAGAGC
GACCGGCAAGGACGCGCGCGCGCCGCGCTCTCCGCCGTCGAGGACCGCCACGCGGCCCTCATCAAGATCGAGCAG
CAGATCGTGGAACTGGCGCAGCTATTCCAGGACATGGACACCCTGGTCGTTCAGCAGGACGCTGCCGTCTTACAG
ATTGAGCAGAAGGGCGAGGAGGTCATCGACAACCTGGACAAGGGCAACGAGGAGATTGGTGTGGCCGTTAAGACG
GCTCGCAAGACGAGGAAGAAGAAGTGGATTTGCCTCGGCATCAGCATTATCATCCTCATCATCATCGTCGTCGTC
GTCCTCGTTTACATCTTTGTTGTCCGCGGCGGACCCCAAAACCTGGTCAATAACGGCAATAACAACAACAACGAC
AACGCAAACAAGCCCGCCAAGCGATCGCCCATGGAATTGATGGATTGGATGAAAGGCCCACAAGGCATGTCTTTC
CCGGTTATCCTGCCAGACGCA
Transcript >Ophio5|5053
ATGGCGCAACAGTACGGATACGGTGCGAGACAGAACCCCTTCGACCAAAGGGACGATGCTCCTGCCTACGGCGCG
CCCTTGAGGCAGCCGACCGGAGGAGGTTATGGTCAGACGTCATCCTACGGCGGCGGCCGAGGCTACAACCAGTCC
ATGGATGCCGGCTACTCAGGTGGCAATGTCGAGATGGCATCCCTTGCCCAGAACGCGGGCTCCTTTGCCGGCGGC
GATCCCAACCAGATTCTCAACGAGTGCAGAGATATCGACCGCGGCATCGATCAGGTCGAGAGCAATCTCGGAAGT
CTTCGCATGCTGCAGAAGCGGACGCTGGACGACGCCGACAGCTCCTCGTCTAGCGCCGCCAACCGCCAGCTCGAT
GCCCTCTCCTCCGAAACCATGTCGCTCTACCGCAGCCTCACCGAGCGCATCCGCACCGTCAAGTCCAATCCCGAC
TCTCGCACCCCCAAGAACAACCCTCAAGTTGGCCGCGTCGACCGACGGTTGAAGGCGGCCATTCAGCAGTATCAG
CAGGTCGAGTCTGAGTTCCGTAAGCGCACGCAGGAACAAATGGCACGCCAGTATCGCATCGTCCGCCCTGACGCC
TCCGAGAGCGAGATCCGCGCCGCCGTCGAGGACACAAATGGCGGTCAAGTCTTTAGCCAGGCCCTGATGCAGAGC
GACCGGCAAGGACGCGCGCGCGCCGCGCTCTCCGCCGTCGAGGACCGCCACGCGGCCCTCATCAAGATCGAGCAG
CAGATCGTGGAACTGGCGCAGCTATTCCAGGACATGGACACCCTGGTCGTTCAGCAGGACGCTGCCGTCTTACAG
ATTGAGCAGAAGGGCGAGGAGGTCATCGACAACCTGGACAAGGGCAACGAGGAGATTGGTGTGGCCGTTAAGACG
GCTCGCAAGACGAGGAAGAAGAAGTGGATTTGCCTCGGCATCAGCATTATCATCCTCATCATCATCGTCGTCGTC
GTCCTCGTTTACATCTTTGTTGTCCGCGGCGGACCCCAAAACCTGGTCAATAACGGCAATAACAACAACAACGAC
AACGCAAACAAGCCCGCCAAGCGATCGCCCATGGAATTGATGGATTGGATGAAAGGCCCACAAGGCATGTCTTTC
CCGGTTATCCTGCCAGACGCATGA
Gene >Ophio5|5053
ATGGCGCAACAGTACGGGTCAGTATCGCTTACCGCTGAGCCTGGTCCAACTTACACTGACAATGCGCGAAGATAC
GGTGCGAGACAGAACCCCTTCGACCAAAGGGACGATGCTCCTGCCTACGGCGCGCCCTTGAGGCAGCCGACCGGA
GGAGGTTATGGTCAGACGTCATCCTACGGCGGCGGCCGAGGCTACAACCAGTCCATGGATGCCGGCTACTCAGGT
GCGTCGGAAGAGCAGAAAACGCTTCAAACTTTTCGCAAGCAAGGCTGACTGTCGGCCGTGACTAGGTGGCAATGT
CGAGATGGCATCCCTTGCCCAGAACGCGGGCTCCTTTGCCGGCGGCGATCCCAACCAGATTCTCAACGAGTGCAG
AGATATCGACCGCGGCATCGATCAGGTCGAGAGCAATCTCGGAAGTCTTCGCATGCTGCAGAAGCGGACGCTGGA
CGACGCCGACAGCTCCTCGTCTAGCGCCGCCAACCGCCAGCTCGATGCCCTCTCCTCCGAAACCATGTCGCTCTA
CCGCAGCCTCACCGAGCGCATCCGCACCGTCAAGTCCAATCCCGACTCTCGCACCCCCAAGAACAACCCTCAAGT
TGGCCGCGTCGACCGACGGTTGAAGGCGGCCATTCAGCAGTATCAGCAGGTCGAGTCTGAGTTCCGTAAGCGCAC
GCAGGAACAAATGGCACGCCAGTATCGCATCGTCCGCCCTGACGCCTCCGAGAGCGAGATCCGCGCCGCCGTCGA
GGACACAAATGGCGGTCAAGTCTTTAGCCAGGCCCTGATGCAGAGCGACCGGCAAGGACGCGCGCGCGCCGCGCT
CTCCGCCGTCGAGGACCGCCACGCGGCCCTCATCAAGATCGAGCAGCAGATCGTGGAACTGGCGCAGCTATTCCA
GGACATGGACACCCTGGTCGTTCAGCAGGACGCTGCCGTCTTACAGATTGAGCAGAAGGGCGAGGAGGTCATCGA
CAACCTGGACAAGGGCAACGAGGAGATTGGTGTGGCCGTTAAGACGGCTCGCAAGACGAGGAAGAAGAAGTGGAT
TTGCCTCGGCATCAGCAGTGAGTGGACTCCCTATCTAAACGATGCGCGGCGGCCTTCTGACCGCAATCCAAAGTT
ATCATCCTCATCATCATCGTCGTCGTCGTCCTCGTTTACATCTTTGTTGTCCGCGGCGGACCCCAAAACCTGGTC
AATAACGGCAATAACAACAACAACGACAACGCAAACAAGCCCGCCAAGCGATCGCCCATGGAATTGATGGATTGG
ATGAAAGGCCCACAAGGCATGTCTTTCCCGGTTATCCTGCCAGACGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail