Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|505
Gene name
Locationscaffold_112:17739..18697
Strand-
Gene length (bp)958
Transcript length (bp)918
Coding sequence length (bp)915
Protein length (aa) 305

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q4HVS2|GNT1_GIBZE Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GNT1 PE=3 SV=1 125 280 5.0E-13
sp|Q4WBL2|GNT1_ASPFU Glucose N-acetyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gnt1 PE=3 SV=1 9 267 2.0E-07
sp|H2KYQ5|GYG1_CAEEL Glycogenin-1 OS=Caenorhabditis elegans GN=gyg-1 PE=1 SV=1 50 266 2.0E-06
sp|P13280|GLYG_RABIT Glycogenin-1 OS=Oryctolagus cuniculus GN=GYG1 PE=1 SV=3 49 281 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 13 30 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|505
MARLLLSLTWIQLRITKAIVVLIIMALVAWKGSMRPTRHLNTVQTGHASSQAYVFYATQDMYTCSVLVNIHVLQN
VLHTRHRIAVLVSGDISADMRQRLEAANATVIEETPPPLHNDTSVPCWLEQILVLDSDQLIMRDLDDTFNTTDAD
FAAPGAYWLDNKTISSTCMLIRPSNALWASVQQAMASIGNDVFDMDLVNDLFRDQNHRLHGSYATLNSHWEDWNV
PGWFNPVSTEKPKEQRASAGDLDALMAEAKIVQFTAVGKPWTYTVDNMQEKRPDAHPLLAQMWRQWRTIAFETCP
TRLFV
Coding >Ophio5|505
ATGGCGCGGCTTTTGCTCAGCTTGACGTGGATTCAACTCCGTATCACCAAAGCCATCGTCGTTCTGATAATCATG
GCCCTGGTTGCATGGAAAGGATCCATGAGACCGACCAGACATCTAAACACAGTCCAAACAGGACACGCGAGCTCC
CAGGCCTACGTCTTTTACGCAACCCAAGACATGTACACTTGCTCAGTCTTGGTCAACATCCATGTGCTGCAAAAC
GTGCTGCATACTCGTCATCGAATCGCCGTCCTCGTATCAGGAGACATTTCCGCCGATATGCGGCAGAGACTGGAG
GCCGCGAACGCGACGGTCATCGAAGAGACTCCGCCACCACTCCACAACGACACCAGTGTGCCATGCTGGCTCGAG
CAAATCCTGGTTCTCGACTCGGACCAATTGATCATGCGAGACCTCGACGACACTTTCAACACGACGGACGCCGAC
TTTGCCGCACCGGGCGCATACTGGCTTGATAATAAGACTATCAGCAGCACTTGCATGCTCATTCGGCCAAGCAAT
GCGCTGTGGGCAAGTGTGCAGCAGGCAATGGCCTCGATCGGCAATGATGTGTTTGACATGGATCTTGTGAACGAC
TTGTTCCGAGACCAGAATCATAGACTGCATGGAAGCTACGCCACCTTGAATAGTCATTGGGAGGACTGGAACGTG
CCCGGCTGGTTCAACCCAGTGTCGACTGAGAAGCCCAAGGAGCAACGCGCTTCCGCAGGCGACCTAGACGCTTTG
ATGGCTGAAGCCAAGATTGTACAATTCACCGCCGTAGGCAAACCATGGACTTACACCGTCGACAACATGCAAGAA
AAGCGGCCAGACGCTCACCCACTCCTCGCGCAAATGTGGAGACAATGGCGAACGATTGCCTTTGAAACCTGTCCG
ACCCGGCTTTTCGTC
Transcript >Ophio5|505
ATGGCGCGGCTTTTGCTCAGCTTGACGTGGATTCAACTCCGTATCACCAAAGCCATCGTCGTTCTGATAATCATG
GCCCTGGTTGCATGGAAAGGATCCATGAGACCGACCAGACATCTAAACACAGTCCAAACAGGACACGCGAGCTCC
CAGGCCTACGTCTTTTACGCAACCCAAGACATGTACACTTGCTCAGTCTTGGTCAACATCCATGTGCTGCAAAAC
GTGCTGCATACTCGTCATCGAATCGCCGTCCTCGTATCAGGAGACATTTCCGCCGATATGCGGCAGAGACTGGAG
GCCGCGAACGCGACGGTCATCGAAGAGACTCCGCCACCACTCCACAACGACACCAGTGTGCCATGCTGGCTCGAG
CAAATCCTGGTTCTCGACTCGGACCAATTGATCATGCGAGACCTCGACGACACTTTCAACACGACGGACGCCGAC
TTTGCCGCACCGGGCGCATACTGGCTTGATAATAAGACTATCAGCAGCACTTGCATGCTCATTCGGCCAAGCAAT
GCGCTGTGGGCAAGTGTGCAGCAGGCAATGGCCTCGATCGGCAATGATGTGTTTGACATGGATCTTGTGAACGAC
TTGTTCCGAGACCAGAATCATAGACTGCATGGAAGCTACGCCACCTTGAATAGTCATTGGGAGGACTGGAACGTG
CCCGGCTGGTTCAACCCAGTGTCGACTGAGAAGCCCAAGGAGCAACGCGCTTCCGCAGGCGACCTAGACGCTTTG
ATGGCTGAAGCCAAGATTGTACAATTCACCGCCGTAGGCAAACCATGGACTTACACCGTCGACAACATGCAAGAA
AAGCGGCCAGACGCTCACCCACTCCTCGCGCAAATGTGGAGACAATGGCGAACGATTGCCTTTGAAACCTGTCCG
ACCCGGCTTTTCGTCTAG
Gene >Ophio5|505
ATGGCGCGGCTTTTGCTCAGCTTGACGTGGATTCAACTCCGTATCACCAAAGCCATCGTCGTTCTGATAATCATG
GCCCTGGTTGCATGGAAAGGATCCATGAGACCGACCAGACATCTAAACACAGTCCAAACAGGACACGCGAGCTCC
CAGGCCTACGTCTTTTACGCAACCCAAGACATGTACACTTGCTCAGTCTTGGTCAACATCCATGTGCTGCAAAAC
GTGCTGCATACTCGTCATCGAATCGCCGTCCTCGTATCAGGAGACATTTCCGCCGATATGCGGCAGAGACTGGAG
GCCGCGAACGCGACGGTCATCGAAGAGACTCCGCCACCACTCCACAACGACACCAGTGTGCCGTACTACAAGGAT
TGTCTGCTGAAGCTCATGACCTTCAAGATGCTGGCTCGAGCAAATCCTGGTTCTCGACTCGGACCAATTGATCAT
GCGAGACCTCGACGACACTTTCAACACGACGGACGCCGACTTTGCCGCACCGGGCGCATACTGGCTTGATAATAA
GACTATCAGCAGCACTTGCATGCTCATTCGGCCAAGCAATGCGCTGTGGGCAAGTGTGCAGCAGGCAATGGCCTC
GATCGGCAATGATGTGTTTGACATGGATCTTGTGAACGACTTGTTCCGAGACCAGAATCATAGACTGCATGGAAG
CTACGCCACCTTGAATAGTCATTGGGAGGACTGGAACGTGCCCGGCTGGTTCAACCCAGTGTCGACTGAGAAGCC
CAAGGAGCAACGCGCTTCCGCAGGCGACCTAGACGCTTTGATGGCTGAAGCCAAGATTGTACAATTCACCGCCGT
AGGCAAACCATGGACTTACACCGTCGACAACATGCAAGAAAAGCGGCCAGACGCTCACCCACTCCTCGCGCAAAT
GTGGAGACAATGGCGAACGATTGCCTTTGAAACCTGTCCGACCCGGCTTTTCGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail