Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5045
Gene name
Locationscaffold_404:4526..5480
Strand+
Gene length (bp)954
Transcript length (bp)900
Coding sequence length (bp)897
Protein length (aa) 299

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02544 Steroid_dh 3-oxo-5-alpha-steroid 4-dehydrogenase 1.6E-11 165 299

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40526|DFG10_YEAST Polyprenol reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DFG10 PE=1 SV=1 18 298 2.0E-18
sp|Q7F0Q2|POED2_ORYSJ Polyprenol reductase 2 OS=Oryza sativa subsp. japonica GN=Os07g0493400 PE=2 SV=1 69 298 1.0E-11
sp|B8B6G5|POED2_ORYSI Polyprenol reductase 2 OS=Oryza sativa subsp. indica GN=OsI_26070 PE=3 SV=2 69 298 2.0E-11
sp|Q7XUH5|POED1_ORYSJ Polyprenol reductase 1 OS=Oryza sativa subsp. japonica GN=Os04g0576800 PE=2 SV=2 69 298 2.0E-11
sp|A2XWN6|POED1_ORYSI Polyprenol reductase 1 OS=Oryza sativa subsp. indica GN=OsI_17065 PE=3 SV=1 69 298 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40526|DFG10_YEAST Polyprenol reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DFG10 PE=1 SV=1 18 298 2.0E-18
sp|Q7F0Q2|POED2_ORYSJ Polyprenol reductase 2 OS=Oryza sativa subsp. japonica GN=Os07g0493400 PE=2 SV=1 69 298 1.0E-11
sp|B8B6G5|POED2_ORYSI Polyprenol reductase 2 OS=Oryza sativa subsp. indica GN=OsI_26070 PE=3 SV=2 69 298 2.0E-11
sp|Q7XUH5|POED1_ORYSJ Polyprenol reductase 1 OS=Oryza sativa subsp. japonica GN=Os04g0576800 PE=2 SV=2 69 298 2.0E-11
sp|A2XWN6|POED1_ORYSI Polyprenol reductase 1 OS=Oryza sativa subsp. indica GN=OsI_17065 PE=3 SV=1 69 298 2.0E-11
sp|Q8AVI9|PORED_XENLA Polyprenol reductase OS=Xenopus laevis GN=srd5a3 PE=2 SV=1 39 299 6.0E-11
sp|Q0P4J9|PORED_XENTR Polyprenol reductase OS=Xenopus tropicalis GN=srd5a3 PE=2 SV=1 69 299 1.0E-10
sp|D2HBV9|PORED_AILME Polyprenol reductase OS=Ailuropoda melanoleuca GN=SRD5A3 PE=3 SV=1 39 283 2.0E-10
sp|Q9H8P0|PORED_HUMAN Polyprenol reductase OS=Homo sapiens GN=SRD5A3 PE=1 SV=1 39 283 7.0E-10
sp|Q5RJM1|PORED_RAT Polyprenol reductase OS=Rattus norvegicus GN=Srd5a3 PE=1 SV=2 39 283 4.0E-09
sp|C7T2J9|PORED_MESAU Polyprenol reductase OS=Mesocricetus auratus GN=Srd5a3 PE=2 SV=1 39 243 6.0E-09
sp|O14264|YFP9_SCHPO Uncharacterized protein C7D4.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC7D4.09c PE=3 SV=3 68 299 1.0E-08
sp|Q9WUP4|PORED_MOUSE Polyprenol reductase OS=Mus musculus GN=Srd5a3 PE=1 SV=2 39 283 1.0E-07
sp|Q5RIU9|PORED_DANRE Polyprenol reductase OS=Danio rerio GN=srd5a3 PE=2 SV=1 35 298 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0071704 organic substance metabolic process No
GO:0016491 oxidoreductase activity No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 15 34 19
2 72 94 22
3 145 167 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 75.46 40.20 110.73
CcL In ants, during behavior modification 1165.88 134.59 2197.17
CcD In ants, recently dead 292.98 144.62 441.33

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.000535 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5045
MATHIAIEAIKPSQWFQTFFLATAVAIVAVHLLPRHFQQRLLQYGARGSDPVRRHGGTSLTSLLLDAHVPHAWFW
HFYLVSVCWSAVWAWQYLTRGALMGALARAQNAPSTELGRVYLAWAMLAAQGCRRLFECFFVLRPGSSPMAWTHW
LLGLVYYTLVNLIVWIHNSGAILASWTSPEPVVLLTPRGLLALPVFLAASLGQNHCHHHLANLPKYTLPCEGLFR
RLICPHYTCECVIYLAIAFVSAPPGSLFNPSLLCVLAMVLANLGATARDTERWYEQKFGRDKVAGRWKMIPFIY
Coding >Ophio5|5045
ATGGCCACGCACATCGCCATCGAAGCCATCAAGCCCTCGCAGTGGTTTCAGACTTTCTTCCTCGCCACGGCAGTT
GCCATCGTCGCCGTCCACCTCCTCCCGCGACACTTCCAGCAGAGATTGCTTCAATATGGCGCTCGCGGTTCCGAC
CCTGTCCGTCGCCATGGCGGCACATCCTTGACGTCGCTGCTCCTCGACGCCCATGTGCCACATGCCTGGTTTTGG
CACTTCTACTTGGTTTCCGTCTGCTGGTCGGCCGTTTGGGCCTGGCAGTATCTCACTCGCGGTGCCTTGATGGGC
GCCCTGGCTCGCGCTCAGAACGCTCCCTCGACCGAGCTGGGCCGTGTCTACCTCGCCTGGGCTATGCTCGCTGCC
CAAGGCTGTAGGCGGCTTTTCGAATGTTTCTTCGTCCTGCGGCCGGGGAGCTCGCCCATGGCATGGACCCATTGG
CTTTTGGGCCTCGTCTATTACACTCTCGTCAACTTGATCGTTTGGATACACAACTCTGGTGCCATCCTGGCGTCG
TGGACGTCGCCAGAACCTGTCGTCCTACTGACGCCGCGTGGGCTGCTGGCCCTGCCGGTCTTCCTGGCCGCATCC
CTGGGGCAAAACCATTGTCACCATCATCTCGCCAACCTTCCCAAGTACACACTTCCCTGCGAGGGCTTGTTTCGT
CGTCTCATCTGCCCTCATTATACCTGCGAGTGCGTCATTTATCTTGCCATCGCCTTCGTCTCGGCGCCGCCCGGC
AGCCTCTTCAATCCGTCCTTGCTCTGCGTCCTCGCCATGGTTTTAGCCAATCTCGGCGCCACCGCCCGCGATACC
GAGCGGTGGTACGAGCAAAAGTTCGGACGGGACAAAGTCGCTGGTCGATGGAAGATGATTCCCTTCATATAC
Transcript >Ophio5|5045
ATGGCCACGCACATCGCCATCGAAGCCATCAAGCCCTCGCAGTGGTTTCAGACTTTCTTCCTCGCCACGGCAGTT
GCCATCGTCGCCGTCCACCTCCTCCCGCGACACTTCCAGCAGAGATTGCTTCAATATGGCGCTCGCGGTTCCGAC
CCTGTCCGTCGCCATGGCGGCACATCCTTGACGTCGCTGCTCCTCGACGCCCATGTGCCACATGCCTGGTTTTGG
CACTTCTACTTGGTTTCCGTCTGCTGGTCGGCCGTTTGGGCCTGGCAGTATCTCACTCGCGGTGCCTTGATGGGC
GCCCTGGCTCGCGCTCAGAACGCTCCCTCGACCGAGCTGGGCCGTGTCTACCTCGCCTGGGCTATGCTCGCTGCC
CAAGGCTGTAGGCGGCTTTTCGAATGTTTCTTCGTCCTGCGGCCGGGGAGCTCGCCCATGGCATGGACCCATTGG
CTTTTGGGCCTCGTCTATTACACTCTCGTCAACTTGATCGTTTGGATACACAACTCTGGTGCCATCCTGGCGTCG
TGGACGTCGCCAGAACCTGTCGTCCTACTGACGCCGCGTGGGCTGCTGGCCCTGCCGGTCTTCCTGGCCGCATCC
CTGGGGCAAAACCATTGTCACCATCATCTCGCCAACCTTCCCAAGTACACACTTCCCTGCGAGGGCTTGTTTCGT
CGTCTCATCTGCCCTCATTATACCTGCGAGTGCGTCATTTATCTTGCCATCGCCTTCGTCTCGGCGCCGCCCGGC
AGCCTCTTCAATCCGTCCTTGCTCTGCGTCCTCGCCATGGTTTTAGCCAATCTCGGCGCCACCGCCCGCGATACC
GAGCGGTGGTACGAGCAAAAGTTCGGACGGGACAAAGTCGCTGGTCGATGGAAGATGATTCCCTTCATATACTAG
Gene >Ophio5|5045
ATGGCCACGCACATCGCCATCGAAGCCATCAAGCCCTCGCAGTGGTTTCAGACTTTCTTCCTCGCCACGGCAGTT
GCCATCGTCGCCGTCCACCTCCTCCCGCGACACTTCCAGCAGAGATTGCTTCAATATGGCGCTCGCGGTTCCGAC
CCTGTCCGTCGCCATGGCGGCACATCCTTGACGTCGCTGCTCCTCGACGCCCATGTGCCACATGCCTGGTTTTGG
CACTTCTACTTGGTTTCCGTCTGCTGGTCGGCCGTTTGGGCCTGGCAGTATCTCACTCGCGGTGCCTTGATGGGC
GCCCTGGCTCGCGCTCAGAACGCTCCCTCGACCGAGCTGGGCCGTGTCTACCTCGCCTGGGCTATGCTCGCTGCC
CAAGGCTGTAGGCGGCTTTTCGAATGTTTCTTCGTCCTGCGGCCGGGGAGCTCGCCCATGGCATGGACCCATTGG
CTTTTGGGCCTCGTCTATTACACTCTCGTCAACTTGATCGTTTGGATACACAACTCTGGTGCGTTCGGCGCCTTT
CCTGTCCCTGCCCTTTTAGGCTGACTCTCGTCCTCAGGTGCCATCCTGGCGTCGTGGACGTCGCCAGAACCTGTC
GTCCTACTGACGCCGCGTGGGCTGCTGGCCCTGCCGGTCTTCCTGGCCGCATCCCTGGGGCAAAACCATTGTCAC
CATCATCTCGCCAACCTTCCCAAGTACACACTTCCCTGCGAGGGCTTGTTTCGTCGTCTCATCTGCCCTCATTAT
ACCTGCGAGTGCGTCATTTATCTTGCCATCGCCTTCGTCTCGGCGCCGCCCGGCAGCCTCTTCAATCCGTCCTTG
CTCTGCGTCCTCGCCATGGTTTTAGCCAATCTCGGCGCCACCGCCCGCGATACCGAGCGGTGGTACGAGCAAAAG
TTCGGACGGGACAAAGTCGCTGGTCGATGGAAGATGATTCCCTTCATATACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail