Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5042
Gene name
Locationscaffold_403:16903..18147
Strand+
Gene length (bp)1244
Transcript length (bp)1083
Coding sequence length (bp)1080
Protein length (aa) 360

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18121 TFA2_Winged_2 TFA2 Winged helix domain 2 4.4E-21 215 275
PF02186 TFIIE_beta TFIIE beta subunit core domain 3.7E-12 138 210

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P79011|T2EB_SCHPO Transcription initiation factor IIE subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfa2 PE=1 SV=2 97 359 2.0E-37
sp|P36145|T2EB_YEAST Transcription initiation factor IIE subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFA2 PE=1 SV=3 139 356 1.0E-34
sp|P29540|T2EB_XENLA General transcription factor IIE subunit 2 OS=Xenopus laevis GN=gtf2e2 PE=2 SV=1 177 356 2.0E-06

GO

GO Term Description Terminal node
GO:0006367 transcription initiation from RNA polymerase II promoter Yes
GO:0009987 cellular process No
GO:1901360 organic cyclic compound metabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0032774 RNA biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0016070 RNA metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006352 DNA-templated transcription, initiation No
GO:0044249 cellular biosynthetic process No
GO:0009058 biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5042
MEHRLRVVFVVVVVVVVVVVVVFVILDSPAGPRRPSPGADAKPYLPRPVRLKQATTMSSYLEKQSSAFRGTLASA
ASKLSNAKTASSVVKAASSLAPPSPSPSAASDSATPTGKRKRETVPEVPFSQPQLTGYGAEVKTQMTFAVEYLKK
KGEAKSMTDIIDHLSLRAYSDDHKRELAEGLRGHPRVEWRPDTGLTEQTWRTGTYGHRPIIPGVRDATSLLAFLQ
RKTDASGVSVKDLKDGWPDCEDALASLEKQHKVLVVRTKKDNFPRYVWLDDASLKHVVQPEFQSKWHHVPLPSLE
DMHRKLVSVGQKPTSEDPRKAVQGLGAKPKGQKKKAGKKVGKATNVHMAHLMQDYSGMRR
Coding >Ophio5|5042
ATGGAACATCGTCTCCGCGTTGTCTTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCTTCGTCATC
CTCGACTCTCCGGCCGGCCCCCGCCGCCCCTCCCCGGGCGCCGACGCTAAACCATATCTCCCCCGTCCGGTCCGC
CTCAAGCAAGCCACCACCATGTCGTCTTACCTGGAGAAGCAGTCGTCGGCCTTTCGCGGCACGCTCGCGTCGGCG
GCGTCGAAGCTTTCCAATGCCAAGACTGCGAGCAGCGTCGTCAAGGCGGCCTCGTCTCTAGCGCCGCCGTCGCCC
TCTCCCTCGGCCGCATCGGACAGCGCGACGCCGACGGGCAAGCGGAAGCGCGAGACGGTACCCGAGGTGCCCTTC
TCGCAGCCGCAGCTGACGGGATACGGCGCCGAGGTCAAGACGCAAATGACGTTTGCCGTCGAATACCTCAAGAAG
AAGGGAGAGGCCAAGTCGATGACGGACATCATCGACCACCTCAGCCTGCGTGCCTACTCGGACGACCACAAGCGC
GAGCTGGCAGAGGGTCTGAGGGGTCATCCTCGCGTCGAGTGGAGGCCGGACACGGGGTTGACGGAGCAGACTTGG
CGGACCGGCACCTACGGCCACAGGCCCATCATCCCGGGCGTGCGAGACGCAACCTCGTTACTGGCCTTTCTGCAG
CGCAAGACGGATGCCTCGGGCGTGTCTGTCAAGGATCTCAAGGACGGCTGGCCCGACTGTGAGGATGCGCTCGCC
TCGCTCGAGAAGCAGCACAAGGTTCTCGTTGTGCGGACCAAAAAGGACAACTTTCCGCGCTACGTCTGGCTCGAC
GATGCTTCGCTCAAGCACGTCGTCCAGCCCGAGTTTCAGTCCAAGTGGCATCATGTCCCGCTACCCAGTCTCGAA
GACATGCACCGGAAGCTGGTCAGCGTCGGACAGAAGCCCACGAGCGAGGATCCCCGCAAGGCGGTCCAGGGTCTC
GGCGCAAAGCCCAAGGGGCAGAAGAAGAAGGCAGGAAAGAAGGTGGGCAAGGCTACCAATGTCCACATGGCGCAC
TTGATGCAGGACTACAGCGGTATGCGGAGG
Transcript >Ophio5|5042
ATGGAACATCGTCTCCGCGTTGTCTTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCTTCGTCATC
CTCGACTCTCCGGCCGGCCCCCGCCGCCCCTCCCCGGGCGCCGACGCTAAACCATATCTCCCCCGTCCGGTCCGC
CTCAAGCAAGCCACCACCATGTCGTCTTACCTGGAGAAGCAGTCGTCGGCCTTTCGCGGCACGCTCGCGTCGGCG
GCGTCGAAGCTTTCCAATGCCAAGACTGCGAGCAGCGTCGTCAAGGCGGCCTCGTCTCTAGCGCCGCCGTCGCCC
TCTCCCTCGGCCGCATCGGACAGCGCGACGCCGACGGGCAAGCGGAAGCGCGAGACGGTACCCGAGGTGCCCTTC
TCGCAGCCGCAGCTGACGGGATACGGCGCCGAGGTCAAGACGCAAATGACGTTTGCCGTCGAATACCTCAAGAAG
AAGGGAGAGGCCAAGTCGATGACGGACATCATCGACCACCTCAGCCTGCGTGCCTACTCGGACGACCACAAGCGC
GAGCTGGCAGAGGGTCTGAGGGGTCATCCTCGCGTCGAGTGGAGGCCGGACACGGGGTTGACGGAGCAGACTTGG
CGGACCGGCACCTACGGCCACAGGCCCATCATCCCGGGCGTGCGAGACGCAACCTCGTTACTGGCCTTTCTGCAG
CGCAAGACGGATGCCTCGGGCGTGTCTGTCAAGGATCTCAAGGACGGCTGGCCCGACTGTGAGGATGCGCTCGCC
TCGCTCGAGAAGCAGCACAAGGTTCTCGTTGTGCGGACCAAAAAGGACAACTTTCCGCGCTACGTCTGGCTCGAC
GATGCTTCGCTCAAGCACGTCGTCCAGCCCGAGTTTCAGTCCAAGTGGCATCATGTCCCGCTACCCAGTCTCGAA
GACATGCACCGGAAGCTGGTCAGCGTCGGACAGAAGCCCACGAGCGAGGATCCCCGCAAGGCGGTCCAGGGTCTC
GGCGCAAAGCCCAAGGGGCAGAAGAAGAAGGCAGGAAAGAAGGTGGGCAAGGCTACCAATGTCCACATGGCGCAC
TTGATGCAGGACTACAGCGGTATGCGGAGGTGA
Gene >Ophio5|5042
ATGGAAGTACCTACCTACCCATGGACAAAATGCACGCCTCGAGCATCCTCTAATCATTCGATTAATAAGCGCCAG
GTACTCGGCCGCAAGAACCCGCCACCTCCCTTCCTCAACCTCGCCTCTTCCCGGGGAAGTTTGTCCCCCTTTCGG
CACCGACGACGGACCAGCATCGTCTCCGCGTTGTCTTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCG
TCTTCGTCATCCTCGACTCTCCGGCCGGCCCCCGCCGCCCCTCCCCGGGCGCCGACGCTAAACCATATCTCCCCC
GTCCGGTCCGCCTCAAGCAAGCCACCACCATGTCGTCTTACCTGGAGAAGCAGTCGTCGGCCTTTCGCGGCACGC
TCGCGTCGGCGGCGTCGAAGCTTTCCAATGCCAAGACTGCGAGCAGCGTCGTCAAGGCGGCCTCGTCTCTAGCGC
CGCCGTCGCCCTCTCCCTCGGCCGCATCGGACAGCGCGACGCCGACGGGCAAGCGGAAGCGCGAGACGGTACCCG
AGGTGCCCTTCTCGCAGCCGCAGCTGACGGGATACGGCGCCGAGGTCAAGACGCAAATGACGTTTGCCGTCGAAT
ACCTCAAGAAGAAGGGAGAGGCCAAGTCGATGACGGACATCATCGACCACCTCAGCCTGCGTGCCTACTCGGACG
ACCACAAGCGCGAGCTGGCAGAGGGTCTGAGGGGTCATCCTCGCGTCGAGTGGAGGCCGGACACGGGGTTGACGG
AGCAGACTTGGCGGACCGGCACCTACGGCCACAGGCCCATCATCCCGGGCGTGCGAGACGCAACCTCGTTACTGG
CCTTTCTGCAGCGCAAGACGGATGCCTCGGGCGTGTCTGTCAAGGATCTCAAGGACGGCTGGCCCGACTGTGAGG
ATGCGCTCGCCTCGCTCGAGAAGCAGCACAAGGTTCTCGTTGTGCGGACCAAAAAGGACAACTTTCCGCGCTACG
TCTGGCTCGACGATGCTTCGCTCAAGCACGTCGTCCAGCCCGAGTTTCAGTCCAAGTGGCATCATGTCCCGCTAC
CCAGTCTCGAAGACATGCACCGGAAGCTGGTCAGCGTCGGACAGAAGCCCACGAGCGAGGATCCCCGCAAGGCGG
TCCAGGGTCTCGGCGCAAAGCCCAAGGGGCAGAAGAAGAAGGCAGGAAAGAAGGTGGGCAAGGCTACCAATGTCC
ACATGGCGCACTTGATGCAGGACTACAGCGGTATGCGGAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail