Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5028
Gene name
Locationscaffold_402:5289..7491
Strand+
Gene length (bp)2202
Transcript length (bp)2073
Coding sequence length (bp)2070
Protein length (aa) 690

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01363 FYVE FYVE zinc finger 4.5E-17 335 415
PF11464 Rbsn Rabenosyn Rab binding domain 4.6E-16 629 669

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P32609|PEP7_YEAST Vacuolar segregation protein PEP7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP7 PE=1 SV=2 79 674 6.0E-60
sp|O13786|PEP7_SCHPO Vacuolar segregation protein pep7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pep7 PE=3 SV=1 57 679 4.0E-59
sp|Q9H1K0|RBNS5_HUMAN Rabenosyn-5 OS=Homo sapiens GN=RBSN PE=1 SV=2 258 666 5.0E-15
sp|Q80Y56|RBNS5_MOUSE Rabenosyn-5 OS=Mus musculus GN=Rbsn PE=1 SV=1 257 541 3.0E-12

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Lysosome/Vacuole 0.5148 0.2581 0.0278 0.2208 0.0966 0.0042 0.47 0.8586 0.3178 0.0142

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup960
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5519
Ophiocordyceps australis map64 (Brazil) OphauB2|2188
Ophiocordyceps camponoti-floridani Ophcf2|05518
Ophiocordyceps camponoti-rufipedis Ophun1|3791
Ophiocordyceps kimflemingae Ophio5|5028 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7325
Ophiocordyceps subramaniannii Hirsu2|7326

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5028
MSVRRLGGGRILGSGKGLAPPTPPAASSRSGSPFAPSESSASLGSISLSPPASGSLTDLGHDIGSSISVGAQAGG
RVADGSGLVCPICSEEMMTLLQLNRHIDDNHQELPAQEQDEVKTWFDKQVLKAKRFQPLTLINQKLRGLDVFESN
ESNPLPPQPTTGGKQPFGGPIDPEELITRNHWQRPTAHDVCTDPTCGRGLGPIVGNINCRKCGRLFCEEHTMYQM
KLSRSANHEPVRGYWARVCETCYKSREGYNDHVGVSVSHTLFFSEMRRKRVERQKLETSRLEKRLTKLTRLLAEL
PDNSSVANAGSLLSPVSSLMGHKDPRKLLEQSVVPWEDDDAVLKCPFCQQEFGSWTFRRHHCRICGRVVCADAQT
GCSSEVSLNIRSAAPAYSEKTKTDEMQADIRMCRDCNQTIFSHRDFAASLEHKPPDQKAYETLRQFERGIRLLLP
AFHRTLATLQPAKLSNGEVDVSKAPPTHAQIQEAGKIRKRLIDSFGKYGATAKRLRALETDNPSQKRLQEAVYSH
ASSFLHTNMLPLKSLPGLLRDSSSNGNNHHRHHHHHHHHNHHHHQQQQQQQQQQQQRLMIPPSSLRHTELASDAA
SSSQDASDDASSSTLLEAEEKDVKERLAVLYEQRHMVQDMVKRATGARRFDEVAALARNIDELDAEIRSLDERVR
LLDLRWEGVYRHGPA
Coding >Ophio5|5028
ATGTCTGTCCGGAGGCTCGGAGGCGGCCGCATCCTCGGCAGCGGCAAAGGCCTGGCGCCGCCAACGCCTCCCGCG
GCTTCGTCTCGCTCCGGCAGCCCTTTTGCGCCTTCGGAGAGCTCTGCCTCTCTCGGTTCCATATCGCTGTCGCCG
CCCGCCTCCGGAAGCTTGACTGACCTCGGCCATGATATCGGCTCCAGCATCAGCGTTGGGGCCCAGGCCGGGGGC
CGGGTTGCGGATGGGTCGGGCTTGGTGTGTCCGATTTGCAGCGAGGAGATGATGACGCTGCTGCAGCTCAATCGA
CACATCGACGACAACCATCAAGAGCTCCCCGCGCAGGAACAGGACGAGGTCAAGACTTGGTTCGACAAGCAAGTC
CTCAAGGCCAAGCGCTTCCAGCCCTTGACCCTCATCAACCAGAAACTCCGAGGCCTCGACGTCTTCGAATCCAAC
GAGTCCAACCCGCTCCCTCCGCAGCCGACGACCGGCGGCAAGCAGCCCTTTGGCGGGCCCATCGACCCGGAAGAG
CTCATCACTCGAAATCACTGGCAGCGCCCGACGGCACACGATGTCTGTACGGACCCCACCTGCGGAAGAGGACTC
GGTCCCATCGTCGGCAACATCAACTGCAGAAAGTGCGGACGGCTGTTCTGTGAAGAGCATACCATGTATCAAATG
AAGCTGAGCAGAAGCGCAAACCACGAACCCGTCCGAGGCTACTGGGCTCGCGTCTGCGAAACTTGCTACAAGTCT
AGGGAGGGATACAACGACCACGTCGGCGTATCTGTCAGCCACACCCTGTTCTTCTCCGAGATGCGGCGAAAGAGA
GTGGAGCGGCAGAAGCTCGAGACGTCGAGGCTGGAGAAGCGACTCACCAAGCTGACGCGTCTGCTGGCAGAGCTT
CCGGACAACTCGTCCGTCGCAAATGCCGGCTCCCTCCTGAGTCCCGTCTCGTCGTTGATGGGACACAAGGATCCG
CGCAAGCTGCTGGAGCAGTCGGTCGTGCCATGGGAGGACGACGATGCCGTGCTCAAGTGTCCCTTTTGCCAGCAA
GAGTTTGGCAGCTGGACGTTTAGGAGACATCACTGCCGGATATGCGGCCGCGTCGTCTGTGCCGATGCGCAGACG
GGCTGCTCGTCTGAAGTCAGCCTCAACATCCGCAGCGCGGCCCCGGCCTACTCGGAAAAGACCAAGACGGACGAG
ATGCAAGCCGACATACGAATGTGCCGCGACTGCAACCAGACCATCTTCTCGCACCGCGACTTTGCCGCCTCTCTC
GAGCACAAACCGCCCGATCAGAAAGCGTACGAAACGCTCCGTCAATTCGAGCGTGGCATCCGTCTCCTCCTGCCC
GCTTTCCATCGCACCCTGGCCACGCTCCAACCAGCCAAGCTCAGCAACGGCGAAGTCGACGTGTCGAAAGCGCCC
CCCACGCACGCCCAGATTCAAGAAGCCGGCAAGATTCGTAAACGACTCATCGACAGCTTCGGCAAGTACGGAGCC
ACGGCGAAGCGTCTCCGGGCGCTCGAGACGGACAATCCGAGTCAGAAACGACTGCAAGAGGCAGTGTACTCGCAT
GCCAGCTCGTTTTTGCATACGAACATGCTACCCCTGAAAAGCCTACCCGGCCTGCTTCGCGATTCTTCCTCGAAC
GGCAACAATCACCACCGTCATCACCATCACCATCACCATCATAATCATCATCATCATCAGCAGCAGCAGCAGCAG
CAGCAGCAGCAGCAGCAGCGCCTCATGATCCCCCCTTCCAGCCTCCGCCACACCGAACTCGCCTCCGACGCCGCC
TCGTCGTCGCAGGACGCGAGCGACGACGCGAGCAGCAGCACCCTCCTCGAAGCAGAGGAGAAGGACGTCAAGGAA
CGGCTGGCGGTCTTGTACGAGCAGAGACACATGGTGCAGGACATGGTCAAGAGGGCGACGGGCGCTCGCCGCTTT
GACGAGGTGGCTGCCCTGGCTCGGAATATCGACGAGCTGGATGCTGAGATTCGGTCGCTGGATGAGCGCGTTCGT
CTGCTTGACCTTCGGTGGGAGGGTGTATATCGTCATGGTCCTGCC
Transcript >Ophio5|5028
ATGTCTGTCCGGAGGCTCGGAGGCGGCCGCATCCTCGGCAGCGGCAAAGGCCTGGCGCCGCCAACGCCTCCCGCG
GCTTCGTCTCGCTCCGGCAGCCCTTTTGCGCCTTCGGAGAGCTCTGCCTCTCTCGGTTCCATATCGCTGTCGCCG
CCCGCCTCCGGAAGCTTGACTGACCTCGGCCATGATATCGGCTCCAGCATCAGCGTTGGGGCCCAGGCCGGGGGC
CGGGTTGCGGATGGGTCGGGCTTGGTGTGTCCGATTTGCAGCGAGGAGATGATGACGCTGCTGCAGCTCAATCGA
CACATCGACGACAACCATCAAGAGCTCCCCGCGCAGGAACAGGACGAGGTCAAGACTTGGTTCGACAAGCAAGTC
CTCAAGGCCAAGCGCTTCCAGCCCTTGACCCTCATCAACCAGAAACTCCGAGGCCTCGACGTCTTCGAATCCAAC
GAGTCCAACCCGCTCCCTCCGCAGCCGACGACCGGCGGCAAGCAGCCCTTTGGCGGGCCCATCGACCCGGAAGAG
CTCATCACTCGAAATCACTGGCAGCGCCCGACGGCACACGATGTCTGTACGGACCCCACCTGCGGAAGAGGACTC
GGTCCCATCGTCGGCAACATCAACTGCAGAAAGTGCGGACGGCTGTTCTGTGAAGAGCATACCATGTATCAAATG
AAGCTGAGCAGAAGCGCAAACCACGAACCCGTCCGAGGCTACTGGGCTCGCGTCTGCGAAACTTGCTACAAGTCT
AGGGAGGGATACAACGACCACGTCGGCGTATCTGTCAGCCACACCCTGTTCTTCTCCGAGATGCGGCGAAAGAGA
GTGGAGCGGCAGAAGCTCGAGACGTCGAGGCTGGAGAAGCGACTCACCAAGCTGACGCGTCTGCTGGCAGAGCTT
CCGGACAACTCGTCCGTCGCAAATGCCGGCTCCCTCCTGAGTCCCGTCTCGTCGTTGATGGGACACAAGGATCCG
CGCAAGCTGCTGGAGCAGTCGGTCGTGCCATGGGAGGACGACGATGCCGTGCTCAAGTGTCCCTTTTGCCAGCAA
GAGTTTGGCAGCTGGACGTTTAGGAGACATCACTGCCGGATATGCGGCCGCGTCGTCTGTGCCGATGCGCAGACG
GGCTGCTCGTCTGAAGTCAGCCTCAACATCCGCAGCGCGGCCCCGGCCTACTCGGAAAAGACCAAGACGGACGAG
ATGCAAGCCGACATACGAATGTGCCGCGACTGCAACCAGACCATCTTCTCGCACCGCGACTTTGCCGCCTCTCTC
GAGCACAAACCGCCCGATCAGAAAGCGTACGAAACGCTCCGTCAATTCGAGCGTGGCATCCGTCTCCTCCTGCCC
GCTTTCCATCGCACCCTGGCCACGCTCCAACCAGCCAAGCTCAGCAACGGCGAAGTCGACGTGTCGAAAGCGCCC
CCCACGCACGCCCAGATTCAAGAAGCCGGCAAGATTCGTAAACGACTCATCGACAGCTTCGGCAAGTACGGAGCC
ACGGCGAAGCGTCTCCGGGCGCTCGAGACGGACAATCCGAGTCAGAAACGACTGCAAGAGGCAGTGTACTCGCAT
GCCAGCTCGTTTTTGCATACGAACATGCTACCCCTGAAAAGCCTACCCGGCCTGCTTCGCGATTCTTCCTCGAAC
GGCAACAATCACCACCGTCATCACCATCACCATCACCATCATAATCATCATCATCATCAGCAGCAGCAGCAGCAG
CAGCAGCAGCAGCAGCAGCGCCTCATGATCCCCCCTTCCAGCCTCCGCCACACCGAACTCGCCTCCGACGCCGCC
TCGTCGTCGCAGGACGCGAGCGACGACGCGAGCAGCAGCACCCTCCTCGAAGCAGAGGAGAAGGACGTCAAGGAA
CGGCTGGCGGTCTTGTACGAGCAGAGACACATGGTGCAGGACATGGTCAAGAGGGCGACGGGCGCTCGCCGCTTT
GACGAGGTGGCTGCCCTGGCTCGGAATATCGACGAGCTGGATGCTGAGATTCGGTCGCTGGATGAGCGCGTTCGT
CTGCTTGACCTTCGGTGGGAGGGTGTATATCGTCATGGTCCTGCCTGA
Gene >Ophio5|5028
ATGTCTGTCCGGAGGCTCGGAGGCGGCCGCATCCTCGGCAGCGGCAAAGGCCTGGCGCCGCCAACGCCTCCCGCG
GCTTCGTCTCGCTCCGGCAGCCCTTTTGCGCCTTCGGAGAGCTCTGCCTCTCTCGGTTCCATATCGCTGTCGCCG
CCCGCCTCCGGAAGCTTGACTGACCTCGGCCATGATATCGGCTCCAGCATCAGCGTTGGGGCCCAGGCCGGGGGC
CGGGTTGCGGATGGGTCGGGCTTGGTGTGTCCGATTTGCAGCGAGGAGATGGTAAAATTGACGCATCTTTTTTTG
AATTCTCCGGATTTTCTCACTGAACCTCTACAGATGACGCTGCTGCAGCTCAATCGACACATCGACGACAACCAT
CAAGAGCTCCCCGCGCAGGAACAGGACGAGGTCAAGACTTGGTTCGACAAGCAAGTCCTCAAGGCCAAGCGCTTC
CAGCCCTTGACCCTCATCAACCAGAAACTCCGAGGCCTCGACGTCTTCGAATCCAACGAGTCCAACCCGCTCCCT
CCGCAGCCGACGACCGGCGGCAAGCAGCCCTTTGGCGGGCCCATCGACCCGGAAGAGCTCATCACTCGAAATCAC
TGGCAGCGCCCGACGGCACACGATGTCTGTACGGACCCCACCTGCGGAAGAGGACTCGGTCCCATCGTCGGCAAC
ATCAACTGCAGAAAGTGCGGACGGCTGTTCTGTGAAGAGCATACCATGTATCAAATGAAGCTGAGCAGAAGCGCA
AACCACGAACCCGTCCGAGGCTACTGGGCTCGCGTCTGCGAAACTTGCTACAAGTCTAGGGAGGGATACAACGAC
CACGTCGGCGTATCTGTCAGCCACACCCTGTTCTTCTCCGAGATGCGGCGAAAGAGAGTGGAGCGGCAGAAGCTC
GAGACGTCGAGGCTGGAGAAGCGACTCACCAAGCTGACGCGTCTGCTGGCAGAGCTTCCGGACAACTCGTCCGTC
GCAAATGCCGGCTCCCTCCTGAGTCCCGTCTCGTCGTTGATGGGACACAAGGATCCGCGCAAGCTGCTGGAGCAG
TCGGTCGTGCCATGGGAGGACGACGATGCCGTGCTCAAGTGTCCCTTTTGCCAGCAAGAGTTTGGCAGCTGGACG
TTTAGGAGACATCACTGCCGGATATGCGGCCGCGTCGTCTGTGCCGATGCGCAGACGGGCTGCTCGTCTGAAGTC
AGCCTCAACATCCGCAGCGGTGAGTTGTCGCTTTCTGGCTATTCTTGTCTGTCGTGTCGAGTGCTTTACTGAAAA
TGAAGGTCCCCAACAGCGGCCCCGGCCTACTCGGAAAAGACCAAGACGGACGAGATGCAAGCCGACATACGAATG
TGCCGCGACTGCAACCAGACCATCTTCTCGCACCGCGACTTTGCCGCCTCTCTCGAGCACAAACCGCCCGATCAG
AAAGCGTACGAAACGCTCCGTCAATTCGAGCGTGGCATCCGTCTCCTCCTGCCCGCTTTCCATCGCACCCTGGCC
ACGCTCCAACCAGCCAAGCTCAGCAACGGCGAAGTCGACGTGTCGAAAGCGCCCCCCACGCACGCCCAGATTCAA
GAAGCCGGCAAGATTCGTAAACGACTCATCGACAGCTTCGGCAAGTACGGAGCCACGGCGAAGCGTCTCCGGGCG
CTCGAGACGGACAATCCGAGTCAGAAACGACTGCAAGAGGCAGTGTACTCGCATGCCAGCTCGTTTTTGCATACG
AACATGCTACCCCTGAAAAGCCTACCCGGCCTGCTTCGCGATTCTTCCTCGAACGGCAACAATCACCACCGTCAT
CACCATCACCATCACCATCATAATCATCATCATCATCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCGC
CTCATGATCCCCCCTTCCAGCCTCCGCCACACCGAACTCGCCTCCGACGCCGCCTCGTCGTCGCAGGACGCGAGC
GACGACGCGAGCAGCAGCACCCTCCTCGAAGCAGAGGAGAAGGACGTCAAGGAACGGCTGGCGGTCTTGTACGAG
CAGAGACACATGGTGCAGGACATGGTCAAGAGGGCGACGGGCGCTCGCCGCTTTGACGAGGTGGCTGCCCTGGCT
CGGAATATCGACGAGCTGGATGCTGAGATTCGGTCGCTGGATGAGCGCGTTCGTCTGCTTGACCTTCGGTGGGAG
GGTGTATATCGTCATGGTCCTGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail