Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5007
Gene name
Locationscaffold_40:52242..52557
Strand+
Gene length (bp)315
Transcript length (bp)246
Coding sequence length (bp)243
Protein length (aa) 81

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0727 0.047 0.9572 0.0853 0.0596 0.0081 0.1236 0.1528 0.1186 0.004

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999761

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 14.05 0.0 28.84
CcL In ants, during behavior modification 0.64 0.0 2.11
CcD In ants, recently dead 0.00 0.0 0.00

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.274982 no
SC16a CcD 0.000286 yes
CcL CcD 1.000000 no

Orthologs

Orthofinder run ID4
Orthogroup2390
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1437
Ophiocordyceps australis map64 (Brazil) OphauB2|6037
Ophiocordyceps camponoti-floridani Ophcf2|03791
Ophiocordyceps camponoti-rufipedis Ophun1|6621
Ophiocordyceps kimflemingae Ophio5|5007 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3371

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5007
MVSTVTLLVALGGLLSAATANLKPTTIPQIIDDCESRTVCIDMINSCGNLYGTCIPACLPRPTFTPQPCTLSSVV
KTYPTP
Coding >Ophio5|5007
ATGGTCTCGACAGTCACTCTTCTCGTCGCTCTTGGGGGGCTTCTCAGCGCAGCAACTGCTAATCTGAAGCCGACT
ACGATACCGCAAATCATCGATGACTGCGAATCGCGGACAGTCTGTATCGACATGATCAACAGCTGCGGCAACTTG
TACGGAACCTGCATACCTGCCTGCCTGCCACGTCCGACTTTCACTCCTCAGCCATGCACATTGTCATCAGTCGTC
AAGACCTACCCGACCCCG
Transcript >Ophio5|5007
ATGGTCTCGACAGTCACTCTTCTCGTCGCTCTTGGGGGGCTTCTCAGCGCAGCAACTGCTAATCTGAAGCCGACT
ACGATACCGCAAATCATCGATGACTGCGAATCGCGGACAGTCTGTATCGACATGATCAACAGCTGCGGCAACTTG
TACGGAACCTGCATACCTGCCTGCCTGCCACGTCCGACTTTCACTCCTCAGCCATGCACATTGTCATCAGTCGTC
AAGACCTACCCGACCCCGTAA
Gene >Ophio5|5007
ATGGTCTCGACAGTCACTCTTCTCGTCGCTCTTGGGGGGCTTCTCAGCGCAGCAACTGCTAATCTGAAGCCGACT
ACGATACCGCAAATCATCGATGACTGCGAATCGCGGACAGTCTGTATCGACATGATCAACAGCTGCGGCAACTTG
TACGGAACGTAAGTGTCCCCCCTTTTGTCTCTGCTGCTGTGAGCGGCGCCGTTCTGACTTGGCTTGTTTTTTTGA
AGCTGCATACCTGCCTGCCTGCCACGTCCGACTTTCACTCCTCAGCCATGCACATTGTCATCAGTCGTCAAGACC
TACCCGACCCCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail