Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5003
Gene name
Locationscaffold_40:38747..39765
Strand-
Gene length (bp)1018
Transcript length (bp)846
Coding sequence length (bp)843
Protein length (aa) 281

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02544 Steroid_dh 3-oxo-5-alpha-steroid 4-dehydrogenase 1.6E-21 118 280
PF06966 DUF1295 Protein of unknown function (DUF1295) 1.7E-04 162 245

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT20|YFY8_SCHPO Uncharacterized protein C9.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9.08c PE=3 SV=1 43 281 2.0E-35
sp|Q68FF9|S5A1_MOUSE 3-oxo-5-alpha-steroid 4-dehydrogenase 1 OS=Mus musculus GN=Srd5a1 PE=2 SV=2 25 281 3.0E-24
sp|P24008|S5A1_RAT 3-oxo-5-alpha-steroid 4-dehydrogenase 1 OS=Rattus norvegicus GN=Srd5a1 PE=1 SV=2 51 281 5.0E-22
sp|A5PJS2|S5A1_BOVIN 3-oxo-5-alpha-steroid 4-dehydrogenase 1 OS=Bos taurus GN=SRD5A1 PE=2 SV=1 45 281 5.0E-21
sp|P18405|S5A1_HUMAN 3-oxo-5-alpha-steroid 4-dehydrogenase 1 OS=Homo sapiens GN=SRD5A1 PE=1 SV=1 43 265 4.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT20|YFY8_SCHPO Uncharacterized protein C9.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9.08c PE=3 SV=1 43 281 2.0E-35
sp|Q68FF9|S5A1_MOUSE 3-oxo-5-alpha-steroid 4-dehydrogenase 1 OS=Mus musculus GN=Srd5a1 PE=2 SV=2 25 281 3.0E-24
sp|P24008|S5A1_RAT 3-oxo-5-alpha-steroid 4-dehydrogenase 1 OS=Rattus norvegicus GN=Srd5a1 PE=1 SV=2 51 281 5.0E-22
sp|A5PJS2|S5A1_BOVIN 3-oxo-5-alpha-steroid 4-dehydrogenase 1 OS=Bos taurus GN=SRD5A1 PE=2 SV=1 45 281 5.0E-21
sp|P18405|S5A1_HUMAN 3-oxo-5-alpha-steroid 4-dehydrogenase 1 OS=Homo sapiens GN=SRD5A1 PE=1 SV=1 43 265 4.0E-19
sp|Q5K2N1|DET2_SOLLC Steroid 5-alpha-reductase DET2 OS=Solanum lycopersicum GN=DET2 PE=1 SV=1 25 280 8.0E-19
sp|Q28891|S5A1_MACFA 3-oxo-5-alpha-steroid 4-dehydrogenase 1 OS=Macaca fascicularis GN=SRD5A1 PE=1 SV=1 43 265 1.0E-18
sp|P31213|S5A2_HUMAN 3-oxo-5-alpha-steroid 4-dehydrogenase 2 OS=Homo sapiens GN=SRD5A2 PE=1 SV=1 29 278 4.0E-17
sp|Q28892|S5A2_MACFA 3-oxo-5-alpha-steroid 4-dehydrogenase 2 OS=Macaca fascicularis GN=SRD5A2 PE=1 SV=1 29 278 1.0E-16
sp|O18765|S5A2_PIG 3-oxo-5-alpha-steroid 4-dehydrogenase 2 OS=Sus scrofa GN=SRD5A2 PE=2 SV=2 41 278 4.0E-16
sp|Q99N99|S5A2_MOUSE 3-oxo-5-alpha-steroid 4-dehydrogenase 2 OS=Mus musculus GN=Srd5a2 PE=2 SV=1 40 278 4.0E-15
sp|Q2QDF6|DET2_GOSHI Steroid 5-alpha-reductase DET2 OS=Gossypium hirsutum GN=DET2 PE=1 SV=1 16 278 9.0E-14
sp|Q38944|DET2_ARATH Steroid 5-alpha-reductase DET2 OS=Arabidopsis thaliana GN=DET2 PE=1 SV=2 58 278 1.0E-13
sp|P31214|S5A2_RAT 3-oxo-5-alpha-steroid 4-dehydrogenase 2 OS=Rattus norvegicus GN=Srd5a2 PE=1 SV=1 40 278 3.0E-13
sp|Q7XUH5|POED1_ORYSJ Polyprenol reductase 1 OS=Oryza sativa subsp. japonica GN=Os04g0576800 PE=2 SV=2 181 278 5.0E-06
sp|A2XWN6|POED1_ORYSI Polyprenol reductase 1 OS=Oryza sativa subsp. indica GN=OsI_17065 PE=3 SV=1 181 278 5.0E-06
sp|Q7F0Q2|POED2_ORYSJ Polyprenol reductase 2 OS=Oryza sativa subsp. japonica GN=Os07g0493400 PE=2 SV=1 181 278 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0071704 organic substance metabolic process No
GO:0016491 oxidoreductase activity No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 55 77 22
3 92 114 22
4 121 143 22
5 158 177 19
6 222 244 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5003
MALIQGWIPPSTRSRHETLLLFWQLAYPAIGSMQWLIKWYGMGKTSTPSRLNLPGRPAWLTMEVPGFLMLLYVMR
TMPAQHGIQDLPWQNQVLAGLFVIHYIYRAVLFPFLQPSMAPIHLFVWLLAISFQLINASCLGSWLAAYGPVTPT
AWAAQTPLPQFILGTVVFYLGLAANFFHDEELREIRRRRSNESGKNGRNSHYEIPQGGLFRYVLYPHYLCEWIEW
TGFLMAAGWTCAPAWAFLVNEVFSMLPRAVRGKAWYIDRFGRDKVAGRWAVIPGLL
Coding >Ophio5|5003
ATGGCCCTCATCCAGGGGTGGATCCCGCCTTCGACGCGCTCTCGCCACGAGACGCTCCTGTTATTCTGGCAGCTG
GCCTATCCCGCCATTGGCTCGATGCAGTGGCTCATCAAGTGGTACGGCATGGGCAAGACTTCAACGCCAAGCAGG
CTTAATCTTCCCGGCCGACCTGCGTGGTTGACGATGGAGGTGCCGGGTTTCTTGATGTTGTTGTATGTGATGCGT
ACGATGCCGGCGCAGCATGGGATACAGGACCTTCCGTGGCAGAATCAGGTCCTAGCCGGTTTATTTGTCATCCAC
TACATCTACCGCGCCGTCCTCTTTCCCTTCCTCCAACCCTCCATGGCCCCGATTCATCTCTTCGTCTGGCTCTTG
GCCATCAGCTTCCAACTCATAAATGCGAGCTGTCTAGGCTCCTGGCTCGCCGCCTACGGACCAGTCACGCCAACC
GCCTGGGCCGCGCAGACGCCCCTTCCGCAATTCATACTCGGCACCGTCGTATTTTACCTTGGCCTTGCCGCCAAC
TTCTTTCACGATGAGGAACTGCGTGAGATTCGTCGTCGTCGCTCAAATGAGAGTGGAAAGAATGGCAGAAATAGC
CACTACGAGATCCCGCAGGGTGGCCTCTTTCGCTACGTCCTCTATCCGCATTATCTCTGCGAGTGGATTGAGTGG
ACTGGCTTCCTTATGGCTGCTGGTTGGACATGCGCGCCCGCCTGGGCCTTTTTGGTCAACGAGGTGTTTTCCATG
CTGCCGCGTGCCGTCCGTGGCAAGGCTTGGTATATCGACCGCTTTGGCCGTGACAAGGTAGCCGGTCGCTGGGCC
GTCATCCCGGGGCTGCTT
Transcript >Ophio5|5003
ATGGCCCTCATCCAGGGGTGGATCCCGCCTTCGACGCGCTCTCGCCACGAGACGCTCCTGTTATTCTGGCAGCTG
GCCTATCCCGCCATTGGCTCGATGCAGTGGCTCATCAAGTGGTACGGCATGGGCAAGACTTCAACGCCAAGCAGG
CTTAATCTTCCCGGCCGACCTGCGTGGTTGACGATGGAGGTGCCGGGTTTCTTGATGTTGTTGTATGTGATGCGT
ACGATGCCGGCGCAGCATGGGATACAGGACCTTCCGTGGCAGAATCAGGTCCTAGCCGGTTTATTTGTCATCCAC
TACATCTACCGCGCCGTCCTCTTTCCCTTCCTCCAACCCTCCATGGCCCCGATTCATCTCTTCGTCTGGCTCTTG
GCCATCAGCTTCCAACTCATAAATGCGAGCTGTCTAGGCTCCTGGCTCGCCGCCTACGGACCAGTCACGCCAACC
GCCTGGGCCGCGCAGACGCCCCTTCCGCAATTCATACTCGGCACCGTCGTATTTTACCTTGGCCTTGCCGCCAAC
TTCTTTCACGATGAGGAACTGCGTGAGATTCGTCGTCGTCGCTCAAATGAGAGTGGAAAGAATGGCAGAAATAGC
CACTACGAGATCCCGCAGGGTGGCCTCTTTCGCTACGTCCTCTATCCGCATTATCTCTGCGAGTGGATTGAGTGG
ACTGGCTTCCTTATGGCTGCTGGTTGGACATGCGCGCCCGCCTGGGCCTTTTTGGTCAACGAGGTGTTTTCCATG
CTGCCGCGTGCCGTCCGTGGCAAGGCTTGGTATATCGACCGCTTTGGCCGTGACAAGGTAGCCGGTCGCTGGGCC
GTCATCCCGGGGCTGCTTTGA
Gene >Ophio5|5003
ATGGCCCTCATCCAGGGGTGGATCCCGCCTTCGACGCGCTCTCGCCACGAGACGCTCCTGTTATTCTGGCAGCTG
GCCTATCCCGCCGCAAGTCTCTCTCCCTAATTCGTGAAGGCGAATCCGCCACTAATGCCGGGCCTTTTTTTTTCT
CTTTTTGTCGGTGATCTTGTACAGATTGGCTCGATGCAGTGGCTCATCAAGTGGTACGGCATGGGCAAGACTTCA
ACGCCAAGCAGGCTTAATCTTCCCGGCCGACCTGCGTGGTTGACGATGGAGGTGCCGGGTTTCTTGATGTTGTTG
TATGTGATGCGTACGATGCCGGCGCAGCATGGGATACAGGACCTTCCGTGGCAGAATCAGGTCCTAGCCGGTTTA
TTTGTTCGTCTTTCTCTCATCTCTCTCTCTCTTTCTCTTCTTGCCACTCTTGTCATTCGCTGACCAAAGCCCTCC
CCCTTCAAAATAGGTCATCCACTACATCTACCGCGCCGTCCTCTTTCCCTTCCTCCAACCCTCCATGGCCCCGAT
TCATCTCTTCGTCTGGCTCTTGGCCATCAGCTTCCAACTCATAAATGCGAGCTGTCTAGGCTCCTGGCTCGCCGC
CTACGGACCAGTCACGCCAACCGCCTGGGCCGCGCAGACGCCCCTTCCGCAATTCATACTCGGCACCGTCGTATT
TTACCTTGGCCTTGCCGCCAACTTCTTTCACGATGAGGAACTGCGTGAGATTCGTCGTCGTCGCTCAAATGAGAG
TGGAAAGAATGGCAGAAATAGCCACTACGAGATCCCGCAGGGTGGCCTCTTTCGCTACGTCCTCTATCCGCATTA
TCTCTGCGAGTGGATTGAGTGGACTGGCTTCCTTATGGCTGCTGGTTGGACATGCGCGCCCGCCTGGGCCTTTTT
GGTCAACGAGGTGTTTTCCATGCTGCCGCGTGCCGTCCGTGGCAAGGCTTGGTATATCGACCGCTTTGGCCGTGA
CAAGGTAGCCGGTCGCTGGGCCGTCATCCCGGGGCTGCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail