Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5000
Gene name
Locationscaffold_40:29421..31406
Strand-
Gene length (bp)1985
Transcript length (bp)1821
Coding sequence length (bp)1818
Protein length (aa) 606

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01424 R3H R3H domain 2.1E-09 322 378
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.1E-04 180 250

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09868|CIP2_SCHPO RNA-binding post-transcriptional regulator cip2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cip2 PE=1 SV=1 173 481 4.0E-49
sp|P34217|PIN4_YEAST RNA-binding protein PIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIN4 PE=1 SV=1 148 281 4.0E-38
sp|O42923|CIP1_SCHPO RNA-binding post-transcriptional regulator cip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cip1 PE=1 SV=1 172 376 1.0E-37

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.7648 0.3303 0.0797 0.067 0.0838 0.0004 0.0878 0.039 0.0299 0.0037

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3753
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2950
Ophiocordyceps australis map64 (Brazil) OphauB2|2922
Ophiocordyceps camponoti-floridani Ophcf2|03784
Ophiocordyceps camponoti-rufipedis Ophun1|589
Ophiocordyceps kimflemingae Ophio5|5000 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7316

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5000
MSQQPHDMGYLDYTSAANRSPNSSRQNYSSFTAGLSLPRQSQRPLDAPLGSSALYPTDRIPAGFNPRAMDNMSVN
AAMHGGYMLDNGQAWNYSTAGVATVNGAVHGPNRQRSVNRRAALPQTWTDHGAMAMPNTLQPFPATINGGHMQNG
GLRLEQGPSHTSPDLRSTASDGDQLIPTAIVIKNIPFAVRKETLASIMLDMNLPQPYAFNYHFDNGVFRGLAFAN
FQSADDTRVVIDAMNGMDVHGRKLRVEYKKMLPEAERERIEREKRERRGQLEEQHRAPMLHQQASLQSLGGLSQS
QQRSTSGHLGDVDLNDPQTLEFYTELAMFKRDDSREVLVFPPSIIPEHRRSIHILAHHMGLEHQSMGEADSRQLT
VLKRQQPSPTANVQNASVVNSLDMHKRGLSRAATFDFAADRESRTANSNYAHAMGRQGPTLELPGSPDGSGIPNN
LRAAKSFADLRSFTPSPSQASSSYLAPGVSSIGPTTTARFGDYMGHVQQGVQPGTSGTPGPKGDNGLGVALGGLS
LSPFDSGVMQAQQTRNAPGAIGSQRPGNSKTAPERQPRIPDWESSAGFGGRGAGSNGHAQRGSDSSENGARAVPS
TTGRYH
Coding >Ophio5|5000
ATGAGCCAGCAACCTCACGACATGGGCTACCTGGACTACACTTCGGCTGCCAACCGCTCGCCGAACTCGTCCAGG
CAAAACTACAGCTCCTTTACTGCCGGCTTGTCCCTGCCCCGACAATCCCAGCGCCCTCTGGACGCTCCCCTAGGC
TCGTCTGCCCTCTATCCCACCGACCGCATACCGGCTGGCTTCAACCCTCGCGCCATGGATAACATGTCCGTCAAC
GCCGCCATGCACGGCGGCTACATGCTCGACAACGGCCAGGCCTGGAACTACAGCACCGCCGGCGTCGCCACCGTC
AACGGCGCCGTCCACGGGCCCAACCGTCAGCGCAGCGTCAATCGTCGCGCCGCCCTGCCACAGACTTGGACCGAC
CACGGCGCCATGGCTATGCCCAACACGCTACAGCCCTTCCCTGCCACGATCAATGGCGGTCACATGCAGAACGGC
GGCCTGCGTCTCGAGCAGGGCCCGTCGCACACGTCGCCCGATCTTCGATCGACCGCCTCGGACGGTGACCAGCTG
ATCCCCACGGCCATTGTCATAAAAAACATACCCTTCGCCGTCCGCAAGGAGACACTAGCGTCCATCATGCTCGAC
ATGAACCTCCCCCAGCCTTACGCTTTCAACTACCACTTCGATAATGGCGTCTTCCGCGGCCTTGCCTTTGCCAAC
TTCCAGTCGGCCGACGACACGCGTGTCGTCATCGATGCCATGAACGGGATGGACGTTCACGGCCGCAAGCTTCGC
GTCGAGTACAAGAAGATGCTGCCCGAGGCAGAGCGGGAACGTATCGAGCGTGAGAAGCGGGAGCGTCGTGGCCAG
CTTGAGGAGCAGCACCGTGCCCCGATGCTGCACCAGCAGGCCTCGCTCCAGTCGCTCGGCGGCCTGTCCCAGTCG
CAGCAGCGCAGCACTTCGGGCCACTTAGGTGACGTCGACCTCAACGATCCCCAGACTCTCGAGTTCTACACGGAG
CTCGCCATGTTCAAGCGTGACGATTCGCGAGAGGTGCTTGTCTTTCCCCCGAGCATCATCCCCGAGCACCGAAGG
TCCATCCACATCCTCGCCCACCACATGGGCCTCGAGCACCAGTCAATGGGCGAGGCCGACTCGCGCCAGCTCACC
GTACTCAAGCGTCAGCAGCCCTCGCCGACGGCCAACGTCCAGAACGCGTCCGTCGTCAACAGCCTCGACATGCAC
AAGCGGGGGCTGAGCCGGGCTGCCACCTTTGACTTTGCCGCCGACAGAGAGTCGCGGACGGCCAACAGCAACTAC
GCCCATGCCATGGGTCGTCAGGGGCCGACGCTCGAACTTCCCGGCAGCCCGGACGGCAGCGGCATCCCCAACAAT
CTTCGGGCGGCCAAGAGCTTCGCCGACCTGCGCTCCTTTACCCCGAGCCCGTCGCAGGCGTCATCGAGCTACCTG
GCCCCCGGCGTCAGCAGCATCGGTCCGACAACGACGGCCCGCTTCGGCGACTACATGGGCCATGTTCAGCAGGGC
GTCCAACCGGGCACCTCGGGCACTCCGGGCCCCAAGGGCGACAACGGCCTCGGCGTGGCGCTCGGCGGCCTGAGC
CTCAGCCCCTTTGACTCCGGTGTCATGCAGGCGCAGCAGACGCGCAATGCCCCCGGTGCCATCGGCAGCCAGCGG
CCCGGCAACTCGAAGACGGCCCCGGAGAGGCAGCCTCGCATCCCCGACTGGGAGTCGTCGGCTGGCTTTGGCGGT
CGTGGGGCCGGGTCCAACGGTCACGCGCAACGCGGCAGCGATTCGTCGGAGAACGGTGCCCGGGCAGTGCCGAGC
ACGACGGGCCGCTATCAC
Transcript >Ophio5|5000
ATGAGCCAGCAACCTCACGACATGGGCTACCTGGACTACACTTCGGCTGCCAACCGCTCGCCGAACTCGTCCAGG
CAAAACTACAGCTCCTTTACTGCCGGCTTGTCCCTGCCCCGACAATCCCAGCGCCCTCTGGACGCTCCCCTAGGC
TCGTCTGCCCTCTATCCCACCGACCGCATACCGGCTGGCTTCAACCCTCGCGCCATGGATAACATGTCCGTCAAC
GCCGCCATGCACGGCGGCTACATGCTCGACAACGGCCAGGCCTGGAACTACAGCACCGCCGGCGTCGCCACCGTC
AACGGCGCCGTCCACGGGCCCAACCGTCAGCGCAGCGTCAATCGTCGCGCCGCCCTGCCACAGACTTGGACCGAC
CACGGCGCCATGGCTATGCCCAACACGCTACAGCCCTTCCCTGCCACGATCAATGGCGGTCACATGCAGAACGGC
GGCCTGCGTCTCGAGCAGGGCCCGTCGCACACGTCGCCCGATCTTCGATCGACCGCCTCGGACGGTGACCAGCTG
ATCCCCACGGCCATTGTCATAAAAAACATACCCTTCGCCGTCCGCAAGGAGACACTAGCGTCCATCATGCTCGAC
ATGAACCTCCCCCAGCCTTACGCTTTCAACTACCACTTCGATAATGGCGTCTTCCGCGGCCTTGCCTTTGCCAAC
TTCCAGTCGGCCGACGACACGCGTGTCGTCATCGATGCCATGAACGGGATGGACGTTCACGGCCGCAAGCTTCGC
GTCGAGTACAAGAAGATGCTGCCCGAGGCAGAGCGGGAACGTATCGAGCGTGAGAAGCGGGAGCGTCGTGGCCAG
CTTGAGGAGCAGCACCGTGCCCCGATGCTGCACCAGCAGGCCTCGCTCCAGTCGCTCGGCGGCCTGTCCCAGTCG
CAGCAGCGCAGCACTTCGGGCCACTTAGGTGACGTCGACCTCAACGATCCCCAGACTCTCGAGTTCTACACGGAG
CTCGCCATGTTCAAGCGTGACGATTCGCGAGAGGTGCTTGTCTTTCCCCCGAGCATCATCCCCGAGCACCGAAGG
TCCATCCACATCCTCGCCCACCACATGGGCCTCGAGCACCAGTCAATGGGCGAGGCCGACTCGCGCCAGCTCACC
GTACTCAAGCGTCAGCAGCCCTCGCCGACGGCCAACGTCCAGAACGCGTCCGTCGTCAACAGCCTCGACATGCAC
AAGCGGGGGCTGAGCCGGGCTGCCACCTTTGACTTTGCCGCCGACAGAGAGTCGCGGACGGCCAACAGCAACTAC
GCCCATGCCATGGGTCGTCAGGGGCCGACGCTCGAACTTCCCGGCAGCCCGGACGGCAGCGGCATCCCCAACAAT
CTTCGGGCGGCCAAGAGCTTCGCCGACCTGCGCTCCTTTACCCCGAGCCCGTCGCAGGCGTCATCGAGCTACCTG
GCCCCCGGCGTCAGCAGCATCGGTCCGACAACGACGGCCCGCTTCGGCGACTACATGGGCCATGTTCAGCAGGGC
GTCCAACCGGGCACCTCGGGCACTCCGGGCCCCAAGGGCGACAACGGCCTCGGCGTGGCGCTCGGCGGCCTGAGC
CTCAGCCCCTTTGACTCCGGTGTCATGCAGGCGCAGCAGACGCGCAATGCCCCCGGTGCCATCGGCAGCCAGCGG
CCCGGCAACTCGAAGACGGCCCCGGAGAGGCAGCCTCGCATCCCCGACTGGGAGTCGTCGGCTGGCTTTGGCGGT
CGTGGGGCCGGGTCCAACGGTCACGCGCAACGCGGCAGCGATTCGTCGGAGAACGGTGCCCGGGCAGTGCCGAGC
ACGACGGGCCGCTATCACTAG
Gene >Ophio5|5000
ATGAGCCAGCAACCTCACGACATGGGCTACCTGGACTACACTTCGGCTGCCAACCGCTCGCCGAACTCGTCCAGG
CAAAACTACAGCTCCTTTACTGCCGGCTTGTCCCTGCCCCGACAATCCCAGCGCCCTCTGGACGCTCCCCTAGGC
TCGTCTGCCCTCTATCCCACCGACCGCATACCGGCTGGCTTCAACCCTCGCGCCATGGATAACATGTCCGTCAAC
GCCGCCATGCACGGCGGCTACATGCTCGACAACGGCCAGGCCTGGAACTACAGCACCGCCGGCGTCGCCACCGTC
AACGGCGCCGTCCACGGGCCCAACCGTCAGCGCAGCGTCAATCGTCGCGCCGCCCTGCCACAGGTGTGTTTTCCC
CTTTGCTACCGCCCTGCCGACAAAGGCTGACTCTAGGCCTCCAAGACTTGGACCGACCACGGCGCCATGGCTATG
CCCAACACGCTACAGCCCTTCCCTGCCACGATCAATGGCGGTCACATGCAGAACGGCGGCCTGCGTCTCGAGCAG
GGCCCGTCGCACACGTCGCCCGATCTTCGATCGACCGCCTCGGACGGTGACCAGCTGATCCCCACGGCCATTGTC
ATAAAAAACATACCCTTCGCCGTCCGCAAGGAGACACTAGCGTCCATCATGCTCGACATGAACCTCCCCCAGCCT
TACGCTTTCAACTACCACTTCGATAATGGCGTCTTCCGCGGCCTTGCCTTTGCCAACTTCCAGTCGGCCGACGAC
ACGCGTGTCGTCATCGATGCCATGAACGGGATGGACGTTCACGGCCGCAAGCTTCGCGTCGAGTACAAGAAGATG
CTGCCCGAGGCAGAGCGGGAACGTATCGAGCGTGAGAAGCGGGAGCGTCGTGGCCAGCTTGAGGAGCAGCACCGT
GCCCCGATGCTGCACCAGCAGGCCTCGCTCCAGTCGCTCGGCGGCCTGTCCCAGTCGCAGCAGCGCAGCACTTCG
GGCCACTTAGGTAAGGCTGAAATCCCGAGTCTTGTTTCCCTCTGCTGACGCCGTCCAACCCGCAGGTGACGTCGA
CCTCAACGATCCCCAGACTCTCGAGTTCTACACGGAGCTCGCCATGTTCAAGCGTGACGATTCGCGAGAGGTGCT
TGTCTTTCCCCCGAGCATCATCCCCGAGCACCGAAGGTCCATCCACATCCTCGCCCACCACATGGGCCTCGAGCA
CCAGTCAATGGGCGAGGCCGACTCGCGCCAGCTCACCGTACTCAAGCGTCAGCAGCCCTCGCCGACGGCCAACGT
CCAGAACGCGTCCGTCGTCAACAGCCTCGACATGCACAAGCGGGGGCTGAGCCGGGCTGCCACCTTTGACTTTGC
CGCCGACAGAGAGTCGCGGACGGCCAACAGCAACTACGCCCATGCCATGGGTCGTCAGGGGCCGACGCTCGAACT
TCCCGGCAGCCCGGACGGCAGCGGCATCCCCAACAATCTTCGGGCGGCCAAGAGCTTCGCCGACCTGCGCTCCTT
TACCCCGAGCCCGTCGCAGGCGTCATCGAGCTACCTGGCCCCCGGCGTCAGCAGCATCGGTCCGACAACGACGGC
CCGCTTCGGCGACTACATGGGCCATGTTCAGCAGGGCGTCCAACCGGGCACCTCGGGCACTCCGGGCCCCAAGGG
CGACAACGGCCTCGGCGTGGCGCTCGGCGGCCTGAGCCTCAGCCCCTTTGACTCCGGTGTCATGCAGGCGCAGCA
GACGCGCAATGCCCCCGGTGCCATCGGCAGCCAGCGGCCCGGCAACTCGAAGACGGCCCCGGAGAGGCAGCCTCG
CATCCCCGACTGGGAGTCGTCGGCTGGCTTTGGCGGTCGTGGGGCCGGGTCCAACGGTCACGCGCAACGCGGCAG
CGGTAGGTGGCCCCCTGATGCTGCATTATCGACGCCGCTGACGGCTCGACTTAGATTCGTCGGAGAACGGTGCCC
GGGCAGTGCCGAGCACGACGGGCCGCTATCACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail