Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4984
Gene name
Locationscaffold_4:107847..109020
Strand+
Gene length (bp)1173
Transcript length (bp)1110
Coding sequence length (bp)1107
Protein length (aa) 369

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59XX2|MP65_CANAL Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MP65 PE=1 SV=2 115 364 3.0E-71
sp|P53334|SCW4_YEAST Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW4 PE=1 SV=1 115 364 5.0E-64
sp|Q04951|SCW10_YEAST Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW10 PE=1 SV=1 115 364 3.0E-59
sp|P53189|SCW11_YEAST Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW11 PE=1 SV=1 115 364 3.0E-42
sp|A1DBG6|BTGE_NEOFI Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=btgE PE=3 SV=1 112 363 4.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59XX2|MP65_CANAL Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MP65 PE=1 SV=2 115 364 3.0E-71
sp|P53334|SCW4_YEAST Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW4 PE=1 SV=1 115 364 5.0E-64
sp|Q04951|SCW10_YEAST Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW10 PE=1 SV=1 115 364 3.0E-59
sp|P53189|SCW11_YEAST Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW11 PE=1 SV=1 115 364 3.0E-42
sp|A1DBG6|BTGE_NEOFI Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=btgE PE=3 SV=1 112 363 4.0E-42
sp|Q0CEX9|BTGE_ASPTN Probable beta-glucosidase btgE OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=btgE PE=3 SV=1 112 363 6.0E-42
sp|Q2US39|BTGE_ASPOR Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=btgE PE=3 SV=1 111 363 2.0E-41
sp|B8MXP5|BTGE_ASPFN Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=btgE PE=3 SV=1 111 363 2.0E-41
sp|Q4WC60|BTGE_ASPFU Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=btgE PE=3 SV=2 112 363 4.0E-41
sp|B0Y9Q9|BTGE_ASPFC Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=btgE PE=3 SV=2 112 363 4.0E-41
sp|A1C499|BTGE_ASPCL Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=btgE PE=3 SV=1 112 363 8.0E-41
sp|Q5BD29|BTGE_EMENI Probable beta-glucosidase btgE OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=btgE PE=1 SV=1 112 363 1.0E-30
sp|Q2U492|BTGC_ASPOR Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=btgC PE=3 SV=1 128 364 1.0E-18
sp|B8NTP7|BTGC_ASPFN Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=btgC PE=3 SV=2 128 364 1.0E-18
sp|Q0CI96|BTGC_ASPTN Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=btgC PE=3 SV=2 128 364 5.0E-15
sp|A2QN74|BTGC_ASPNC Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=btgC PE=3 SV=2 128 364 9.0E-15
sp|O13990|BGL2_SCHPO Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgl2 PE=2 SV=4 94 363 8.0E-14
sp|A1DEV5|BTGC_NEOFI Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=btgC PE=3 SV=1 128 364 5.0E-13
sp|A1CAI0|BTGC_ASPCL Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=btgC PE=3 SV=1 128 364 9.0E-13
sp|Q5B430|BTGC_EMENI Glucan endo-1,3-beta-glucosidase btgC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=btgC PE=2 SV=1 117 364 2.0E-12
sp|Q4WUK5|BTGC_ASPFU Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=btgC PE=3 SV=1 128 364 3.0E-12
sp|B0Y429|BTGC_ASPFC Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=btgC PE=3 SV=1 128 364 4.0E-12
sp|D4B2W4|BGL2_ARTBC Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02797 PE=1 SV=1 121 364 2.0E-11
sp|P43070|BGL2_CANAX Glucan 1,3-beta-glucosidase OS=Candida albicans GN=BGL2 PE=3 SV=1 123 364 5.0E-08
sp|Q5AMT2|BGL2_CANAL Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BGL2 PE=1 SV=1 123 364 1.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 217.90 112.99 322.81
CcL In ants, during behavior modification 93.08 50.36 135.79
CcD In ants, recently dead 64.84 35.23 94.44

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.108942 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4984
MGLGRFLLPAMALGPFVASHPAGELSQLDRSLPEADAISLPEIVLMDDETGDHLQTIDISVTHTLEPTTDATPQP
QGQGSKGAAGSLPDKPHDVQPAASSMGNGTKPAPTKQFNIAYAPYRADHGCKSQDEIDNDVQHLSKYYSTLRIYG
TDCDQVAKVVKAARASEMNVFAGIWDPKDIENEIKLIQEGVDGNWGIIQFVSVGNELVNSGQATASDMAGAVAEA
RSRLREAGYQGPVVTVDTFGAYQRNKELGEASDHCTINAHAYFDKEISSPDAGQWLKNTVNDVRNSCPQSKKVIV
TETGWPSQGDSNGLAAPGMDEQAAAISSIRQHFAQDPSQVFFFSAFNDLWKSPGNLNTEQYWGINNHTA
Coding >Ophio5|4984
ATGGGCCTCGGACGGTTTCTACTCCCAGCCATGGCACTAGGGCCATTCGTCGCCAGTCATCCCGCCGGTGAGCTT
TCCCAATTAGATCGCAGTCTTCCAGAAGCGGACGCCATCAGTCTGCCCGAAATCGTGCTCATGGACGACGAAACG
GGGGACCATTTACAGACCATCGACATCTCGGTGACGCATACGCTGGAACCCACGACGGACGCTACGCCACAGCCG
CAAGGCCAAGGTTCAAAAGGCGCCGCCGGCTCTTTGCCTGACAAGCCCCACGACGTACAACCAGCTGCCAGCTCG
ATGGGAAACGGCACCAAGCCTGCGCCGACAAAACAGTTTAACATCGCCTATGCACCCTACCGAGCCGATCACGGA
TGCAAGTCACAGGATGAAATCGACAACGATGTTCAGCATTTGAGCAAGTATTACTCGACGCTTCGCATCTACGGC
ACGGACTGCGATCAGGTTGCCAAGGTGGTCAAAGCCGCAAGGGCCTCAGAAATGAATGTCTTTGCCGGTATCTGG
GATCCGAAAGATATTGAAAACGAAATTAAACTCATCCAGGAGGGAGTCGATGGCAACTGGGGCATCATTCAGTTC
GTCAGCGTCGGTAACGAATTGGTTAACAGCGGCCAGGCCACGGCTTCCGATATGGCCGGTGCGGTTGCTGAAGCG
CGTTCTCGACTTCGAGAAGCAGGATACCAAGGTCCGGTTGTGACTGTCGACACTTTTGGGGCCTACCAAAGGAAC
AAGGAACTGGGAGAGGCCTCCGACCACTGCACCATCAATGCGCACGCCTACTTCGACAAGGAAATTTCCTCCCCC
GATGCAGGACAGTGGCTCAAGAACACAGTCAACGACGTCCGAAATTCTTGTCCGCAATCCAAGAAGGTCATCGTC
ACTGAAACGGGATGGCCCTCGCAGGGTGACAGCAACGGCCTAGCAGCTCCGGGCATGGACGAACAGGCAGCTGCC
ATCAGCTCAATCAGGCAACACTTTGCCCAAGACCCTAGCCAAGTCTTCTTCTTCTCTGCCTTTAACGACCTTTGG
AAGAGCCCGGGCAACCTCAACACGGAGCAGTACTGGGGCATCAACAACCACACCGCA
Transcript >Ophio5|4984
ATGGGCCTCGGACGGTTTCTACTCCCAGCCATGGCACTAGGGCCATTCGTCGCCAGTCATCCCGCCGGTGAGCTT
TCCCAATTAGATCGCAGTCTTCCAGAAGCGGACGCCATCAGTCTGCCCGAAATCGTGCTCATGGACGACGAAACG
GGGGACCATTTACAGACCATCGACATCTCGGTGACGCATACGCTGGAACCCACGACGGACGCTACGCCACAGCCG
CAAGGCCAAGGTTCAAAAGGCGCCGCCGGCTCTTTGCCTGACAAGCCCCACGACGTACAACCAGCTGCCAGCTCG
ATGGGAAACGGCACCAAGCCTGCGCCGACAAAACAGTTTAACATCGCCTATGCACCCTACCGAGCCGATCACGGA
TGCAAGTCACAGGATGAAATCGACAACGATGTTCAGCATTTGAGCAAGTATTACTCGACGCTTCGCATCTACGGC
ACGGACTGCGATCAGGTTGCCAAGGTGGTCAAAGCCGCAAGGGCCTCAGAAATGAATGTCTTTGCCGGTATCTGG
GATCCGAAAGATATTGAAAACGAAATTAAACTCATCCAGGAGGGAGTCGATGGCAACTGGGGCATCATTCAGTTC
GTCAGCGTCGGTAACGAATTGGTTAACAGCGGCCAGGCCACGGCTTCCGATATGGCCGGTGCGGTTGCTGAAGCG
CGTTCTCGACTTCGAGAAGCAGGATACCAAGGTCCGGTTGTGACTGTCGACACTTTTGGGGCCTACCAAAGGAAC
AAGGAACTGGGAGAGGCCTCCGACCACTGCACCATCAATGCGCACGCCTACTTCGACAAGGAAATTTCCTCCCCC
GATGCAGGACAGTGGCTCAAGAACACAGTCAACGACGTCCGAAATTCTTGTCCGCAATCCAAGAAGGTCATCGTC
ACTGAAACGGGATGGCCCTCGCAGGGTGACAGCAACGGCCTAGCAGCTCCGGGCATGGACGAACAGGCAGCTGCC
ATCAGCTCAATCAGGCAACACTTTGCCCAAGACCCTAGCCAAGTCTTCTTCTTCTCTGCCTTTAACGACCTTTGG
AAGAGCCCGGGCAACCTCAACACGGAGCAGTACTGGGGCATCAACAACCACACCGCATAG
Gene >Ophio5|4984
ATGGGCCTCGGACGGTTTCTACTCCCAGCCATGGCACTAGGGCCATTCGTCGCCAGTCATCCCGCCGGTGAGCGT
GAGCAAGCGCCTGTTGCGAACATTCTCATGGGCCAGACACTGACCTGATTCGGTGTCCAAGTTTCCCAATTAGAT
CGCAGTCTTCCAGAAGCGGACGCCATCAGTCTGCCCGAAATCGTGCTCATGGACGACGAAACGGGGGACCATTTA
CAGACCATCGACATCTCGGTGACGCATACGCTGGAACCCACGACGGACGCTACGCCACAGCCGCAAGGCCAAGGT
TCAAAAGGCGCCGCCGGCTCTTTGCCTGACAAGCCCCACGACGTACAACCAGCTGCCAGCTCGATGGGAAACGGC
ACCAAGCCTGCGCCGACAAAACAGTTTAACATCGCCTATGCACCCTACCGAGCCGATCACGGATGCAAGTCACAG
GATGAAATCGACAACGATGTTCAGCATTTGAGCAAGTATTACTCGACGCTTCGCATCTACGGCACGGACTGCGAT
CAGGTTGCCAAGGTGGTCAAAGCCGCAAGGGCCTCAGAAATGAATGTCTTTGCCGGTATCTGGGATCCGAAAGAT
ATTGAAAACGAAATTAAACTCATCCAGGAGGGAGTCGATGGCAACTGGGGCATCATTCAGTTCGTCAGCGTCGGT
AACGAATTGGTTAACAGCGGCCAGGCCACGGCTTCCGATATGGCCGGTGCGGTTGCTGAAGCGCGTTCTCGACTT
CGAGAAGCAGGATACCAAGGTCCGGTTGTGACTGTCGACACTTTTGGGGCCTACCAAAGGAACAAGGAACTGGGA
GAGGCCTCCGACCACTGCACCATCAATGCGCACGCCTACTTCGACAAGGAAATTTCCTCCCCCGATGCAGGACAG
TGGCTCAAGAACACAGTCAACGACGTCCGAAATTCTTGTCCGCAATCCAAGAAGGTCATCGTCACTGAAACGGGA
TGGCCCTCGCAGGGTGACAGCAACGGCCTAGCAGCTCCGGGCATGGACGAACAGGCAGCTGCCATCAGCTCAATC
AGGCAACACTTTGCCCAAGACCCTAGCCAAGTCTTCTTCTTCTCTGCCTTTAACGACCTTTGGAAGAGCCCGGGC
AACCTCAACACGGAGCAGTACTGGGGCATCAACAACCACACCGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail