Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4984
Gene name
Locationscaffold_4:107847..109020
Strand+
Gene length (bp)1173
Transcript length (bp)1110
Coding sequence length (bp)1107
Protein length (aa) 369

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59XX2|MP65_CANAL Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MP65 PE=1 SV=2 115 364 3.0E-71
sp|P53334|SCW4_YEAST Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW4 PE=1 SV=1 115 364 5.0E-64
sp|Q04951|SCW10_YEAST Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW10 PE=1 SV=1 115 364 3.0E-59
sp|P53189|SCW11_YEAST Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW11 PE=1 SV=1 115 364 3.0E-42
sp|A1DBG6|BTGE_NEOFI Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=btgE PE=3 SV=1 112 363 4.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59XX2|MP65_CANAL Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MP65 PE=1 SV=2 115 364 3.0E-71
sp|P53334|SCW4_YEAST Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW4 PE=1 SV=1 115 364 5.0E-64
sp|Q04951|SCW10_YEAST Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW10 PE=1 SV=1 115 364 3.0E-59
sp|P53189|SCW11_YEAST Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW11 PE=1 SV=1 115 364 3.0E-42
sp|A1DBG6|BTGE_NEOFI Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=btgE PE=3 SV=1 112 363 4.0E-42
sp|Q0CEX9|BTGE_ASPTN Probable beta-glucosidase btgE OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=btgE PE=3 SV=1 112 363 6.0E-42
sp|Q2US39|BTGE_ASPOR Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=btgE PE=3 SV=1 111 363 2.0E-41
sp|B8MXP5|BTGE_ASPFN Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=btgE PE=3 SV=1 111 363 2.0E-41
sp|Q4WC60|BTGE_ASPFU Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=btgE PE=3 SV=2 112 363 4.0E-41
sp|B0Y9Q9|BTGE_ASPFC Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=btgE PE=3 SV=2 112 363 4.0E-41
sp|A1C499|BTGE_ASPCL Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=btgE PE=3 SV=1 112 363 8.0E-41
sp|Q5BD29|BTGE_EMENI Probable beta-glucosidase btgE OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=btgE PE=1 SV=1 112 363 1.0E-30
sp|Q2U492|BTGC_ASPOR Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=btgC PE=3 SV=1 128 364 1.0E-18
sp|B8NTP7|BTGC_ASPFN Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=btgC PE=3 SV=2 128 364 1.0E-18
sp|Q0CI96|BTGC_ASPTN Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=btgC PE=3 SV=2 128 364 5.0E-15
sp|A2QN74|BTGC_ASPNC Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=btgC PE=3 SV=2 128 364 9.0E-15
sp|O13990|BGL2_SCHPO Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgl2 PE=2 SV=4 94 363 8.0E-14
sp|A1DEV5|BTGC_NEOFI Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=btgC PE=3 SV=1 128 364 5.0E-13
sp|A1CAI0|BTGC_ASPCL Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=btgC PE=3 SV=1 128 364 9.0E-13
sp|Q5B430|BTGC_EMENI Glucan endo-1,3-beta-glucosidase btgC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=btgC PE=2 SV=1 117 364 2.0E-12
sp|Q4WUK5|BTGC_ASPFU Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=btgC PE=3 SV=1 128 364 3.0E-12
sp|B0Y429|BTGC_ASPFC Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=btgC PE=3 SV=1 128 364 4.0E-12
sp|D4B2W4|BGL2_ARTBC Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02797 PE=1 SV=1 121 364 2.0E-11
sp|P43070|BGL2_CANAX Glucan 1,3-beta-glucosidase OS=Candida albicans GN=BGL2 PE=3 SV=1 123 364 5.0E-08
sp|Q5AMT2|BGL2_CANAL Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BGL2 PE=1 SV=1 123 364 1.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4984
MGLGRFLLPAMALGPFVASHPAGELSQLDRSLPEADAISLPEIVLMDDETGDHLQTIDISVTHTLEPTTDATPQP
QGQGSKGAAGSLPDKPHDVQPAASSMGNGTKPAPTKQFNIAYAPYRADHGCKSQDEIDNDVQHLSKYYSTLRIYG
TDCDQVAKVVKAARASEMNVFAGIWDPKDIENEIKLIQEGVDGNWGIIQFVSVGNELVNSGQATASDMAGAVAEA
RSRLREAGYQGPVVTVDTFGAYQRNKELGEASDHCTINAHAYFDKEISSPDAGQWLKNTVNDVRNSCPQSKKVIV
TETGWPSQGDSNGLAAPGMDEQAAAISSIRQHFAQDPSQVFFFSAFNDLWKSPGNLNTEQYWGINNHTA
Coding >Ophio5|4984
ATGGGCCTCGGACGGTTTCTACTCCCAGCCATGGCACTAGGGCCATTCGTCGCCAGTCATCCCGCCGGTGAGCTT
TCCCAATTAGATCGCAGTCTTCCAGAAGCGGACGCCATCAGTCTGCCCGAAATCGTGCTCATGGACGACGAAACG
GGGGACCATTTACAGACCATCGACATCTCGGTGACGCATACGCTGGAACCCACGACGGACGCTACGCCACAGCCG
CAAGGCCAAGGTTCAAAAGGCGCCGCCGGCTCTTTGCCTGACAAGCCCCACGACGTACAACCAGCTGCCAGCTCG
ATGGGAAACGGCACCAAGCCTGCGCCGACAAAACAGTTTAACATCGCCTATGCACCCTACCGAGCCGATCACGGA
TGCAAGTCACAGGATGAAATCGACAACGATGTTCAGCATTTGAGCAAGTATTACTCGACGCTTCGCATCTACGGC
ACGGACTGCGATCAGGTTGCCAAGGTGGTCAAAGCCGCAAGGGCCTCAGAAATGAATGTCTTTGCCGGTATCTGG
GATCCGAAAGATATTGAAAACGAAATTAAACTCATCCAGGAGGGAGTCGATGGCAACTGGGGCATCATTCAGTTC
GTCAGCGTCGGTAACGAATTGGTTAACAGCGGCCAGGCCACGGCTTCCGATATGGCCGGTGCGGTTGCTGAAGCG
CGTTCTCGACTTCGAGAAGCAGGATACCAAGGTCCGGTTGTGACTGTCGACACTTTTGGGGCCTACCAAAGGAAC
AAGGAACTGGGAGAGGCCTCCGACCACTGCACCATCAATGCGCACGCCTACTTCGACAAGGAAATTTCCTCCCCC
GATGCAGGACAGTGGCTCAAGAACACAGTCAACGACGTCCGAAATTCTTGTCCGCAATCCAAGAAGGTCATCGTC
ACTGAAACGGGATGGCCCTCGCAGGGTGACAGCAACGGCCTAGCAGCTCCGGGCATGGACGAACAGGCAGCTGCC
ATCAGCTCAATCAGGCAACACTTTGCCCAAGACCCTAGCCAAGTCTTCTTCTTCTCTGCCTTTAACGACCTTTGG
AAGAGCCCGGGCAACCTCAACACGGAGCAGTACTGGGGCATCAACAACCACACCGCA
Transcript >Ophio5|4984
ATGGGCCTCGGACGGTTTCTACTCCCAGCCATGGCACTAGGGCCATTCGTCGCCAGTCATCCCGCCGGTGAGCTT
TCCCAATTAGATCGCAGTCTTCCAGAAGCGGACGCCATCAGTCTGCCCGAAATCGTGCTCATGGACGACGAAACG
GGGGACCATTTACAGACCATCGACATCTCGGTGACGCATACGCTGGAACCCACGACGGACGCTACGCCACAGCCG
CAAGGCCAAGGTTCAAAAGGCGCCGCCGGCTCTTTGCCTGACAAGCCCCACGACGTACAACCAGCTGCCAGCTCG
ATGGGAAACGGCACCAAGCCTGCGCCGACAAAACAGTTTAACATCGCCTATGCACCCTACCGAGCCGATCACGGA
TGCAAGTCACAGGATGAAATCGACAACGATGTTCAGCATTTGAGCAAGTATTACTCGACGCTTCGCATCTACGGC
ACGGACTGCGATCAGGTTGCCAAGGTGGTCAAAGCCGCAAGGGCCTCAGAAATGAATGTCTTTGCCGGTATCTGG
GATCCGAAAGATATTGAAAACGAAATTAAACTCATCCAGGAGGGAGTCGATGGCAACTGGGGCATCATTCAGTTC
GTCAGCGTCGGTAACGAATTGGTTAACAGCGGCCAGGCCACGGCTTCCGATATGGCCGGTGCGGTTGCTGAAGCG
CGTTCTCGACTTCGAGAAGCAGGATACCAAGGTCCGGTTGTGACTGTCGACACTTTTGGGGCCTACCAAAGGAAC
AAGGAACTGGGAGAGGCCTCCGACCACTGCACCATCAATGCGCACGCCTACTTCGACAAGGAAATTTCCTCCCCC
GATGCAGGACAGTGGCTCAAGAACACAGTCAACGACGTCCGAAATTCTTGTCCGCAATCCAAGAAGGTCATCGTC
ACTGAAACGGGATGGCCCTCGCAGGGTGACAGCAACGGCCTAGCAGCTCCGGGCATGGACGAACAGGCAGCTGCC
ATCAGCTCAATCAGGCAACACTTTGCCCAAGACCCTAGCCAAGTCTTCTTCTTCTCTGCCTTTAACGACCTTTGG
AAGAGCCCGGGCAACCTCAACACGGAGCAGTACTGGGGCATCAACAACCACACCGCATAG
Gene >Ophio5|4984
ATGGGCCTCGGACGGTTTCTACTCCCAGCCATGGCACTAGGGCCATTCGTCGCCAGTCATCCCGCCGGTGAGCGT
GAGCAAGCGCCTGTTGCGAACATTCTCATGGGCCAGACACTGACCTGATTCGGTGTCCAAGTTTCCCAATTAGAT
CGCAGTCTTCCAGAAGCGGACGCCATCAGTCTGCCCGAAATCGTGCTCATGGACGACGAAACGGGGGACCATTTA
CAGACCATCGACATCTCGGTGACGCATACGCTGGAACCCACGACGGACGCTACGCCACAGCCGCAAGGCCAAGGT
TCAAAAGGCGCCGCCGGCTCTTTGCCTGACAAGCCCCACGACGTACAACCAGCTGCCAGCTCGATGGGAAACGGC
ACCAAGCCTGCGCCGACAAAACAGTTTAACATCGCCTATGCACCCTACCGAGCCGATCACGGATGCAAGTCACAG
GATGAAATCGACAACGATGTTCAGCATTTGAGCAAGTATTACTCGACGCTTCGCATCTACGGCACGGACTGCGAT
CAGGTTGCCAAGGTGGTCAAAGCCGCAAGGGCCTCAGAAATGAATGTCTTTGCCGGTATCTGGGATCCGAAAGAT
ATTGAAAACGAAATTAAACTCATCCAGGAGGGAGTCGATGGCAACTGGGGCATCATTCAGTTCGTCAGCGTCGGT
AACGAATTGGTTAACAGCGGCCAGGCCACGGCTTCCGATATGGCCGGTGCGGTTGCTGAAGCGCGTTCTCGACTT
CGAGAAGCAGGATACCAAGGTCCGGTTGTGACTGTCGACACTTTTGGGGCCTACCAAAGGAACAAGGAACTGGGA
GAGGCCTCCGACCACTGCACCATCAATGCGCACGCCTACTTCGACAAGGAAATTTCCTCCCCCGATGCAGGACAG
TGGCTCAAGAACACAGTCAACGACGTCCGAAATTCTTGTCCGCAATCCAAGAAGGTCATCGTCACTGAAACGGGA
TGGCCCTCGCAGGGTGACAGCAACGGCCTAGCAGCTCCGGGCATGGACGAACAGGCAGCTGCCATCAGCTCAATC
AGGCAACACTTTGCCCAAGACCCTAGCCAAGTCTTCTTCTTCTCTGCCTTTAACGACCTTTGGAAGAGCCCGGGC
AACCTCAACACGGAGCAGTACTGGGGCATCAACAACCACACCGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail