Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4978
Gene name
Locationscaffold_4:88837..91474
Strand+
Gene length (bp)2637
Transcript length (bp)2151
Coding sequence length (bp)2148
Protein length (aa) 716

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00650 CRAL_TRIO CRAL/TRIO domain 7.9E-45 447 591
PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain 1.2E-14 349 399
PF13716 CRAL_TRIO_2 Divergent CRAL/TRIO domain 5.2E-06 459 589

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10138|YAS2_SCHPO CRAL-TRIO domain-containing protein C3H8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H8.02 PE=1 SV=1 252 681 1.0E-101
sp|Q757H2|CSR1_ASHGO Phosphatidylinositol transfer protein CSR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSR1 PE=3 SV=2 253 683 3.0E-96
sp|Q06705|CSR1_YEAST Phosphatidylinositol transfer protein CSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSR1 PE=1 SV=1 260 683 2.0E-72
sp|Q9HDZ5|YKP9_SCHPO CRAL-TRIO domain-containing protein C589.09, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC589.09 PE=3 SV=1 358 679 9.0E-59
sp|Q9UUC2|YGR1_SCHPO CRAL-TRIO domain-containing protein C365.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC365.01 PE=2 SV=1 374 693 3.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10138|YAS2_SCHPO CRAL-TRIO domain-containing protein C3H8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H8.02 PE=1 SV=1 252 681 1.0E-101
sp|Q757H2|CSR1_ASHGO Phosphatidylinositol transfer protein CSR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSR1 PE=3 SV=2 253 683 3.0E-96
sp|Q06705|CSR1_YEAST Phosphatidylinositol transfer protein CSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSR1 PE=1 SV=1 260 683 2.0E-72
sp|Q9HDZ5|YKP9_SCHPO CRAL-TRIO domain-containing protein C589.09, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC589.09 PE=3 SV=1 358 679 9.0E-59
sp|Q9UUC2|YGR1_SCHPO CRAL-TRIO domain-containing protein C365.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC365.01 PE=2 SV=1 374 693 3.0E-22
sp|F4JVA9|SFH2_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH2 OS=Arabidopsis thaliana GN=SFH2 PE=2 SV=1 375 592 3.0E-17
sp|Q94A34|SFH12_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH12 OS=Arabidopsis thaliana GN=SFH12 PE=2 SV=1 309 591 3.0E-17
sp|Q9CWP6|MSPD2_MOUSE Motile sperm domain-containing protein 2 OS=Mus musculus GN=Mospd2 PE=1 SV=2 445 599 6.0E-17
sp|F4IHJ0|SFH8_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH8 OS=Arabidopsis thaliana GN=SFH8 PE=2 SV=1 379 591 5.0E-16
sp|Q8NHP6|MSPD2_HUMAN Motile sperm domain-containing protein 2 OS=Homo sapiens GN=MOSPD2 PE=1 SV=1 371 599 6.0E-16
sp|Q9SIW3|SFH7_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH7 OS=Arabidopsis thaliana GN=SFH7 PE=2 SV=2 291 585 6.0E-16
sp|Q10137|SEC14_SCHPO Sec14 cytosolic factor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec14 PE=3 SV=1 377 591 1.0E-15
sp|Q9SI13|SFH10_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH10 OS=Arabidopsis thaliana GN=SFH10 PE=3 SV=1 379 591 3.0E-15
sp|F4J7S8|SFH9_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH9 OS=Arabidopsis thaliana GN=SFH9 PE=2 SV=1 380 591 5.0E-15
sp|F4HP88|SFH4_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH4 OS=Arabidopsis thaliana GN=SFH4 PE=2 SV=1 379 585 6.0E-15
sp|F4JVA6|SFH6_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH6 OS=Arabidopsis thaliana GN=SFH6 PE=2 SV=1 307 591 7.0E-15
sp|Q93ZE9|SFH3_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH3 OS=Arabidopsis thaliana GN=SFH3 PE=2 SV=1 379 591 9.0E-15
sp|F4JLE5|SFH1_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH1 OS=Arabidopsis thaliana GN=SFH1 PE=2 SV=1 379 585 1.0E-14
sp|P33324|YKJ1_YEAST CRAL-TRIO domain-containing protein YKL091C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL091C PE=1 SV=2 372 567 6.0E-13
sp|P45816|SEC14_YARLI SEC14 cytosolic factor OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC14 PE=3 SV=2 377 576 1.0E-12
sp|P46250|SEC14_CANAL SEC14 cytosolic factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC14 PE=2 SV=1 377 594 1.0E-12
sp|Q8GXC6|SFH5_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH5 OS=Arabidopsis thaliana GN=SFH5 PE=2 SV=1 379 591 2.0E-12
sp|Q29JQ0|RETM_DROPS Protein real-time OS=Drosophila pseudoobscura pseudoobscura GN=retm PE=3 SV=1 380 581 3.0E-12
sp|Q55CU8|RSC5_DICDI Random slug protein 5 OS=Dictyostelium discoideum GN=rsc5 PE=2 SV=1 377 613 4.0E-12
sp|F4JYJ3|SFH11_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH11 OS=Arabidopsis thaliana GN=SFH11 PE=3 SV=1 382 585 8.0E-12
sp|P24859|SEC14_KLULA SEC14 cytosolic factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC14 PE=3 SV=2 361 594 1.0E-11
sp|Q92503|S14L1_HUMAN SEC14-like protein 1 OS=Homo sapiens GN=SEC14L1 PE=1 SV=2 377 592 2.0E-11
sp|P24280|SEC14_YEAST SEC14 cytosolic factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC14 PE=1 SV=3 377 567 4.0E-11
sp|Q75DK1|SEC14_ASHGO SEC14 cytosolic factor OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC14 PE=3 SV=2 377 594 4.0E-11
sp|Q7PWB1|RETM_ANOGA Protein real-time OS=Anopheles gambiae GN=retm PE=3 SV=4 374 591 5.0E-11
sp|Q03606|YN02_CAEEL CRAL-TRIO domain-containing protein T23G5.2 OS=Caenorhabditis elegans GN=T23G5.2 PE=3 SV=3 337 560 7.0E-11
sp|Q9VMD6|RETM_DROME Protein real-time OS=Drosophila melanogaster GN=retm PE=1 SV=2 380 581 2.0E-10
sp|Q9UU99|YJX4_SCHPO CRAL-TRIO domain-containing protein C23B6.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC23B6.04c PE=1 SV=1 380 601 3.0E-10
sp|O43304|S14L5_HUMAN SEC14-like protein 5 OS=Homo sapiens GN=SEC14L5 PE=2 SV=3 325 592 4.0E-10
sp|Q16KN5|RETM_AEDAE Protein real-time OS=Aedes aegypti GN=retm PE=3 SV=1 380 591 1.0E-09
sp|Q9D3D0|TTPAL_MOUSE Alpha-tocopherol transfer protein-like OS=Mus musculus GN=Ttpal PE=1 SV=3 365 630 1.0E-08
sp|Q9BTX7|TTPAL_HUMAN Alpha-tocopherol transfer protein-like OS=Homo sapiens GN=TTPAL PE=1 SV=2 365 630 1.0E-08
sp|Q5RFR0|TTPAL_PONAB Alpha-tocopherol transfer protein-like OS=Pongo abelii GN=TTPAL PE=2 SV=1 365 630 2.0E-08
sp|P53860|PDR16_YEAST Phosphatidylinositol transfer protein PDR16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR16 PE=1 SV=1 381 569 4.0E-06
sp|Q501H5|SFH13_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH13 OS=Arabidopsis thaliana GN=SFH13 PE=2 SV=1 380 591 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 209 231 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4978
MTTRTIGDCSCGKESGSRMSGHLSLGSNCPLWNKYIASPSRFTPTDNLLQTDKMHGSAGFSGRLGWVSQGVGSGA
APRPPSSPARASPRGCCQHSAAQSVNPNTLLPPGPLSMSARLIRPAAAQLLTTSIPAAPAPTSRLLRQASAGTCQ
SFDTTLRDGRKPSKNPPAARAVLLSRLITPLPICQTRPCSSEPRLSTSACHHRPVLKSSLGFLYPPIITVAFLAL
ATWLLLNPHSPDSSLSAPVDDMSVNVEAPGHIGNLTPEQEEKLRRLWIAIAKLCAVDVAGENGTAAADNRPESPV
AALEEPDPSPKRRFSLFRRKQAESPTSVAVNIDDAKDGADDDDKYGQTKQFLKTLASQTPQTIRETIWSMVKQDH
PDALVLRFLRARKWDVDRALVMLVSAMNWRFSEMCVDSDIMLNGESGALHDEVNGDEDAKKMGSDFMYQCRVGKC
FLHGTDKQGRPICVVRVRLHKPSGQSAESLERYTVYIIETARLALQYPVDTATIIFDMTGFSLANMDYHPVKFMI
QCFEANYPECLGTILVHNAPWVFQGIWRIIRGWLDPVVAAKVHFTNYRAGLEEYIDPSHIIKELDGEEDWEFKYE
EPVPGENDKMKDTQTRDRLLAARAELYGKFEQETMTWIRSPSSEEGRKARAARDSIAAQLQAGYWELDPYVRSRS
LYDRTGDLMAGGGVNWYKKEEGPKANGNGVHGNGSSAPSTD
Coding >Ophio5|4978
ATGACGACGAGGACAATAGGTGACTGCAGTTGCGGGAAGGAATCTGGGAGCAGGATGTCTGGACATCTTTCCCTC
GGAAGCAATTGCCCCCTTTGGAACAAGTACATAGCCTCTCCCTCCCGCTTCACCCCTACCGACAATCTTCTCCAA
ACGGATAAAATGCACGGTTCGGCCGGATTCAGCGGCCGTCTGGGTTGGGTTAGTCAAGGGGTCGGTTCGGGTGCC
GCCCCCCGCCCACCGTCTTCTCCGGCGCGCGCCTCGCCGCGGGGCTGCTGTCAGCATTCAGCAGCACAATCAGTC
AATCCAAACACCCTCCTGCCTCCTGGCCCGTTGTCGATGAGCGCTCGATTAATTCGTCCAGCCGCCGCCCAGCTT
CTGACGACGTCGATTCCTGCTGCCCCGGCCCCCACGTCCCGGTTGCTACGTCAAGCCTCCGCCGGGACTTGCCAA
TCGTTTGATACGACGCTCCGCGACGGGAGGAAGCCGTCAAAAAATCCTCCGGCCGCCCGTGCCGTCCTCCTTTCA
CGACTCATCACGCCGTTGCCTATCTGCCAGACACGGCCCTGCTCTTCCGAGCCGCGGCTCTCGACAAGCGCGTGC
CACCATCGGCCCGTCCTCAAAAGCTCGCTCGGCTTCCTCTATCCCCCCATCATCACCGTCGCTTTCCTGGCTCTC
GCCACCTGGCTCTTACTGAATCCTCATTCGCCCGACTCGTCCCTCTCCGCCCCCGTCGACGACATGTCTGTCAAC
GTCGAAGCCCCGGGTCACATCGGCAACCTGACTCCTGAGCAGGAGGAGAAGCTGCGCAGGCTGTGGATCGCCATT
GCCAAGCTCTGTGCCGTCGACGTTGCCGGCGAAAATGGCACAGCCGCCGCTGACAACCGCCCGGAGTCGCCCGTC
GCGGCGCTGGAGGAGCCCGATCCGTCTCCAAAGCGGCGCTTCAGTCTCTTCCGGCGCAAGCAGGCCGAGAGTCCA
ACATCAGTCGCCGTCAACATAGACGACGCCAAAGACGGGGCTGACGATGACGACAAGTACGGCCAAACGAAGCAG
TTTCTCAAAACGCTGGCGAGCCAGACGCCGCAAACTATTCGCGAGACCATCTGGTCCATGGTCAAGCAGGACCAC
CCGGACGCGCTCGTCTTGCGATTCTTGCGCGCGCGCAAGTGGGACGTGGACAGGGCGCTCGTCATGCTTGTGTCA
GCCATGAACTGGCGGTTCAGCGAGATGTGTGTCGACAGCGATATTATGCTAAACGGCGAGAGCGGCGCCCTCCAC
GACGAAGTCAACGGCGATGAAGACGCCAAAAAGATGGGCAGTGATTTCATGTACCAGTGTCGCGTGGGCAAATGC
TTCCTTCACGGAACAGACAAGCAAGGGCGCCCCATCTGCGTCGTCCGGGTTCGATTGCACAAGCCGAGCGGTCAG
TCCGCCGAGAGCTTAGAGCGTTACACCGTCTACATCATCGAAACGGCTCGTCTGGCGCTCCAGTATCCCGTCGAT
ACAGCGACCATCATCTTCGACATGACGGGCTTCTCCCTGGCCAACATGGACTATCACCCTGTCAAGTTCATGATT
CAATGCTTCGAGGCAAACTACCCCGAGTGTCTGGGCACCATATTAGTCCACAATGCGCCCTGGGTGTTCCAAGGC
ATCTGGCGAATCATTCGTGGCTGGCTCGACCCCGTCGTCGCCGCCAAAGTCCATTTCACCAACTACAGAGCTGGA
CTAGAAGAGTACATTGACCCGAGCCACATCATCAAGGAGCTTGACGGCGAAGAGGATTGGGAGTTCAAGTATGAA
GAGCCTGTGCCCGGCGAGAACGACAAGATGAAAGACACCCAAACCAGAGACCGACTTCTCGCGGCCAGAGCTGAG
CTCTACGGGAAGTTCGAGCAAGAGACCATGACCTGGATCCGCTCCCCCTCGTCGGAGGAGGGTAGGAAGGCCAGG
GCTGCGCGAGATAGTATCGCGGCGCAATTACAGGCAGGTTACTGGGAACTCGACCCGTACGTGCGCTCTCGGTCT
CTGTACGACAGAACAGGCGACTTGATGGCAGGAGGAGGAGTCAACTGGTACAAGAAAGAGGAGGGACCGAAGGCC
AACGGAAACGGTGTTCATGGTAATGGTAGTAGTGCGCCATCGACGGAT
Transcript >Ophio5|4978
ATGACGACGAGGACAATAGGTGACTGCAGTTGCGGGAAGGAATCTGGGAGCAGGATGTCTGGACATCTTTCCCTC
GGAAGCAATTGCCCCCTTTGGAACAAGTACATAGCCTCTCCCTCCCGCTTCACCCCTACCGACAATCTTCTCCAA
ACGGATAAAATGCACGGTTCGGCCGGATTCAGCGGCCGTCTGGGTTGGGTTAGTCAAGGGGTCGGTTCGGGTGCC
GCCCCCCGCCCACCGTCTTCTCCGGCGCGCGCCTCGCCGCGGGGCTGCTGTCAGCATTCAGCAGCACAATCAGTC
AATCCAAACACCCTCCTGCCTCCTGGCCCGTTGTCGATGAGCGCTCGATTAATTCGTCCAGCCGCCGCCCAGCTT
CTGACGACGTCGATTCCTGCTGCCCCGGCCCCCACGTCCCGGTTGCTACGTCAAGCCTCCGCCGGGACTTGCCAA
TCGTTTGATACGACGCTCCGCGACGGGAGGAAGCCGTCAAAAAATCCTCCGGCCGCCCGTGCCGTCCTCCTTTCA
CGACTCATCACGCCGTTGCCTATCTGCCAGACACGGCCCTGCTCTTCCGAGCCGCGGCTCTCGACAAGCGCGTGC
CACCATCGGCCCGTCCTCAAAAGCTCGCTCGGCTTCCTCTATCCCCCCATCATCACCGTCGCTTTCCTGGCTCTC
GCCACCTGGCTCTTACTGAATCCTCATTCGCCCGACTCGTCCCTCTCCGCCCCCGTCGACGACATGTCTGTCAAC
GTCGAAGCCCCGGGTCACATCGGCAACCTGACTCCTGAGCAGGAGGAGAAGCTGCGCAGGCTGTGGATCGCCATT
GCCAAGCTCTGTGCCGTCGACGTTGCCGGCGAAAATGGCACAGCCGCCGCTGACAACCGCCCGGAGTCGCCCGTC
GCGGCGCTGGAGGAGCCCGATCCGTCTCCAAAGCGGCGCTTCAGTCTCTTCCGGCGCAAGCAGGCCGAGAGTCCA
ACATCAGTCGCCGTCAACATAGACGACGCCAAAGACGGGGCTGACGATGACGACAAGTACGGCCAAACGAAGCAG
TTTCTCAAAACGCTGGCGAGCCAGACGCCGCAAACTATTCGCGAGACCATCTGGTCCATGGTCAAGCAGGACCAC
CCGGACGCGCTCGTCTTGCGATTCTTGCGCGCGCGCAAGTGGGACGTGGACAGGGCGCTCGTCATGCTTGTGTCA
GCCATGAACTGGCGGTTCAGCGAGATGTGTGTCGACAGCGATATTATGCTAAACGGCGAGAGCGGCGCCCTCCAC
GACGAAGTCAACGGCGATGAAGACGCCAAAAAGATGGGCAGTGATTTCATGTACCAGTGTCGCGTGGGCAAATGC
TTCCTTCACGGAACAGACAAGCAAGGGCGCCCCATCTGCGTCGTCCGGGTTCGATTGCACAAGCCGAGCGGTCAG
TCCGCCGAGAGCTTAGAGCGTTACACCGTCTACATCATCGAAACGGCTCGTCTGGCGCTCCAGTATCCCGTCGAT
ACAGCGACCATCATCTTCGACATGACGGGCTTCTCCCTGGCCAACATGGACTATCACCCTGTCAAGTTCATGATT
CAATGCTTCGAGGCAAACTACCCCGAGTGTCTGGGCACCATATTAGTCCACAATGCGCCCTGGGTGTTCCAAGGC
ATCTGGCGAATCATTCGTGGCTGGCTCGACCCCGTCGTCGCCGCCAAAGTCCATTTCACCAACTACAGAGCTGGA
CTAGAAGAGTACATTGACCCGAGCCACATCATCAAGGAGCTTGACGGCGAAGAGGATTGGGAGTTCAAGTATGAA
GAGCCTGTGCCCGGCGAGAACGACAAGATGAAAGACACCCAAACCAGAGACCGACTTCTCGCGGCCAGAGCTGAG
CTCTACGGGAAGTTCGAGCAAGAGACCATGACCTGGATCCGCTCCCCCTCGTCGGAGGAGGGTAGGAAGGCCAGG
GCTGCGCGAGATAGTATCGCGGCGCAATTACAGGCAGGTTACTGGGAACTCGACCCGTACGTGCGCTCTCGGTCT
CTGTACGACAGAACAGGCGACTTGATGGCAGGAGGAGGAGTCAACTGGTACAAGAAAGAGGAGGGACCGAAGGCC
AACGGAAACGGTGTTCATGGTAATGGTAGTAGTGCGCCATCGACGGATTAA
Gene >Ophio5|4978
ATGACGACGAGGACAATAGGGTAGGGGAGACAGAAACGAAAGACGCAACCAAGCACCGCAACGAGGCAGCGACAT
ACTAACCAAATGAAGTGACTGCAGTTGCGGGAAGGAATGTAGGTAGTTAAACGACGATGCTACTATGCGAAACTG
CCCCCGGCTTCGGCGATGGCCCCTCCAAGCTCCCACGGCGGGCTTGCCTCGGCGAACAAGCTGGGAGCAGGATGT
CTGGACATCTTTCCCTCGGAAGCAATTGCCCCCTTTGGAACAAGTACATAGGTAGGTACTAGGCGAGGTGATGAT
GTCGTGTGTCCATTCATTCACCCCATTTGTTCAGCCTCTCCCTCCCGCTTCACCCCTACCGACAATCTTCTCCAA
ACGGATAAAATGCACGGGTAAGGTAGGCAGGTATGCAATGCAGGCAGGCAGGTCTTACTATTACATAGGTAGGTA
GATATACTAGAGTAGGTAGGCACTTGGTAAAGGTAGGTAGGTGGTAGTAGGTTTTGGCCGTTCGCCCCCGCGGCG
CAGTTCGGCCGGATTCAGCGGCCGTCTGGGTTGGGTTAGTCAAGGGGTCGGTTCGGGTGCCGCCCCCCGCCCACC
GTCTTCTCCGGCGCGCGCCTCGCCGCGGGGCTGCTGTCAGCATTCAGCAGCACAATCAGTCAATCCAAACACCCT
CCTGCCTCCTGGCCCGTTGTCGATGAGCGCTCGATTAATTCGTCCAGCCGCCGCCCAGCTTCTGACGACGTCGAT
TCCTGCTGCCCCGGCCCCCACGTCCCGGTTGCTACGTCAAGCCTCCGCCGGGACTTGCCAATCGTTTGATACGAC
GCTCCGCGACGGGAGGAAGCCGTCAAAAAATCCTCCGGCCGCCCGTGCCGTCCTCCTTTCACGACTCATCACGCC
GTTGCCTATCTGCCAGACACGGCCCTGCTCTTCCGAGCCGCGGCTCTCGACAAGCGCGTGCCACCATCGGCCCGT
CCTCAAAAGCTCGCTCGGCTTCCTCTATCCCCCCATCATCACCGTCGCTTTCCTGGCTCTCGCCACCTGGCTCTT
ACTGAATCCTCATTCGCCCGACTCGTCCCTCTCCGCCCCCGTCGACGACATGTCTGTCAACGTCGAAGCCCCGGG
TCACATCGGCAACCTGACTCCTGAGCAGGAGGAGAAGCTGCGCAGGCTGTGGATCGCCATTGCCAAGCTCTGTGC
CGTCGACGTTGCCGGCGAAAATGGCACAGCCGCCGCTGACAACCGCCCGGAGTCGCCCGTCGCGGCGCTGGAGGA
GCCCGATCCGTCTCCAAAGCGGCGCTTCAGTCTCTTCCGGCGCAAGCAGGCCGAGAGTCCAACATCAGTCGCCGT
CAACATAGACGACGCCAAAGACGGGGCTGACGATGACGACAAGTACGGCCAAACGAAGCAGTTTCTCAAAACGCT
GGCGAGCCAGACGCCGCAAACTATTCGCGAGACCATCTGGTCCATGGTCAAGCAGGACCACCCGGACGCGCTCGT
CTTGCGATTCTTGCGCGCGCGCAAGTGGGACGTGGACAGGGCGCTCGTCATGCTTGTGTCAGCCATGAACTGGCG
GTTCAGCGAGATGTGTGTCGACAGCGATATTATGCTAAACGGCGAGAGCGGCGCCCTCCACGACGAAGTCAACGG
CGATGAAGACGCCAAAAAGATGGGCAGTGATTTCATGTACCAGTGTCGCGTGGGCAAATGCTTCCTTCACGGAAC
AGACAAGCAAGGGCGCCCCATCTGCGTCGTCCGGGTTCGATTGCACAAGCCGAGCGGTCAGTCCGCCGAGAGCTT
AGAGCGTTACACCGTCTACATCATCGAAACGGCTCGTCTGGCGCTCCAGTATCCCGTCGATACAGCGGTCGGCCC
AACCCCCTTCCCCCGCCCGCCTAATCTAGCCAAGGCATGCAGCTGACGATCCCCACCCCTTTAGACCATCATCTT
CGACATGACGGGCTTCTCCCTGGCCAACATGGACTATCACCCTGTCAAGTTCATGATTCAATGCTTCGAGGCAAA
CTACCCCGAGTGTCTGGGCACCATATTAGTCCACAATGCGCCCTGGGTGTTCCAAGGTTTGCTGGCCCTCAGCTG
CACGAGAGTAGCAAGTTGACTTACGATGCACTAGGCATCTGGCGAATCATTCGTGGCTGGCTCGACCCCGTCGTC
GCCGCCAAAGTCCATTTCACCAACTACAGAGCTGGACTAGAAGAGTACATTGACCCGAGCCACATCATCAAGGAG
CTTGACGGCGAAGAGGATTGGGAGTTCAAGTATGAAGAGCCTGTGCCCGGCGAGAACGACAAGATGAAAGACACC
CAAACCAGAGACCGACTTCTCGCGGCCAGAGCTGAGCTCTACGGGAAGTTCGAGCAAGAGACCATGACCTGGATC
CGCTCCCCCTCGTCGGAGGAGGGTAGGAAGGCCAGGGCTGCGCGAGATAGTATCGCGGCGCAATTACAGGCAGGT
TACTGGGAACTCGACCCGTACGTGCGCTCTCGGTCTCTGTACGACAGAACAGGCGACTTGATGGCAGGAGGAGGA
GTCAACTGGTACAAGAAAGAGGAGGGACCGAAGGCCAACGGAAACGGTGTTCATGGTAATGGTAGTAGTGCGCCA
TCGACGGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail